Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | D9C11_RS11495 | Genome accession | NZ_CP032855 |
| Coordinates | 2121886..2122176 (-) | Length | 96 a.a. |
| NCBI ID | WP_003226760.1 | Uniprot ID | A0A7G9PCZ4 |
| Organism | Bacillus subtilis subsp. subtilis strain PJ-7 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2065789..2132336 | 2121886..2122176 | within | 0 |
Gene organization within MGE regions
Location: 2065789..2132336
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C11_RS11195 (D9C11_11195) | - | 2065789..2066939 (+) | 1151 | WP_087614157.1 | IS3 family transposase | - |
| D9C11_RS11200 (D9C11_11200) | spo0J | 2067002..2067850 (-) | 849 | WP_003226832.1 | stage 0 sporulation protein Spo0J | - |
| D9C11_RS11205 (D9C11_11205) | soj | 2067843..2068604 (-) | 762 | WP_003219244.1 | sporulation initiation inhibitor protein Soj | - |
| D9C11_RS11210 (D9C11_11210) | yyaB | 2068852..2069292 (+) | 441 | WP_043858423.1 | PH domain-containing protein | - |
| D9C11_RS11215 (D9C11_11215) | noc | 2069343..2070194 (-) | 852 | WP_003226829.1 | nucleoid occlusion protein | - |
| D9C11_RS11220 (D9C11_11220) | rsmG | 2070316..2071035 (-) | 720 | WP_015250777.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| D9C11_RS11225 (D9C11_11225) | mnmG | 2071049..2072935 (-) | 1887 | WP_003226825.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
| D9C11_RS11230 (D9C11_11230) | mnmE | 2072957..2074336 (-) | 1380 | WP_014478576.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| D9C11_RS11235 (D9C11_11235) | jag | 2074647..2075273 (-) | 627 | WP_069837912.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| D9C11_RS11240 (D9C11_11240) | spoIIIJ | 2075270..2076055 (-) | 786 | WP_010886648.1 | YidC family membrane integrase SpoIIIJ | - |
| D9C11_RS11245 (D9C11_11245) | rnpA | 2076199..2076549 (-) | 351 | WP_014481515.1 | ribonuclease P protein component | - |
| D9C11_RS11250 (D9C11_11250) | rpmH | 2076701..2076835 (-) | 135 | WP_003178075.1 | 50S ribosomal protein L34 | - |
| D9C11_RS11255 (D9C11_11255) | dnaA | 2077462..2078802 (+) | 1341 | WP_003242674.1 | chromosomal replication initiator protein DnaA | - |
| D9C11_RS11260 (D9C11_11260) | dnaN | 2078990..2080126 (+) | 1137 | WP_003226811.1 | DNA polymerase III subunit beta | - |
| D9C11_RS11265 (D9C11_11265) | rlbA | 2080257..2080472 (+) | 216 | WP_121591351.1 | ribosome maturation protein RlbA | - |
| D9C11_RS11270 (D9C11_11270) | recF | 2080488..2081600 (+) | 1113 | WP_041054955.1 | DNA replication/repair protein RecF | Machinery gene |
| D9C11_RS11275 (D9C11_11275) | remB | 2081618..2081863 (+) | 246 | WP_003219266.1 | extracellular matrix regulator RemB | - |
| D9C11_RS11280 (D9C11_11280) | gyrB | 2081918..2083834 (+) | 1917 | WP_003226808.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| D9C11_RS11285 (D9C11_11285) | gyrA | 2084045..2086510 (+) | 2466 | WP_014475555.1 | DNA topoisomerase (ATP-hydrolyzing) subunit A | - |
| D9C11_RS11315 (D9C11_11315) | yaaC | 2091897..2092844 (-) | 948 | WP_121591984.1 | YaaC family protein | - |
| D9C11_RS11320 (D9C11_11320) | guaB | 2092965..2094431 (+) | 1467 | WP_003226803.1 | IMP dehydrogenase | - |
| D9C11_RS11325 (D9C11_11325) | dacA | 2094584..2095915 (+) | 1332 | WP_014478582.1 | D-alanyl-D-alanine carboxypeptidase | - |
| D9C11_RS11330 (D9C11_11330) | pdxS | 2096112..2096996 (+) | 885 | WP_014478583.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| D9C11_RS11335 (D9C11_11335) | pdxT | 2097018..2097608 (+) | 591 | WP_003226797.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| D9C11_RS11340 (D9C11_11340) | serS | 2097930..2099207 (+) | 1278 | WP_003247131.1 | serine--tRNA ligase | - |
| D9C11_RS11350 (D9C11_11350) | dck | 2099546..2100199 (-) | 654 | WP_003226792.1 | deoxyadenosine/deoxycytidine kinase | - |
| D9C11_RS11355 (D9C11_11355) | dgk | 2100196..2100819 (-) | 624 | WP_003226790.1 | deoxyguanosine kinase | - |
| D9C11_RS11360 (D9C11_11360) | sleL | 2100918..2102201 (-) | 1284 | WP_121591352.1 | glycoside hydrolase family 18 protein | - |
| D9C11_RS11365 (D9C11_11365) | yaaI | 2102271..2102816 (-) | 546 | WP_121591353.1 | isochorismatase family cysteine hydrolase | - |
| D9C11_RS11370 (D9C11_11370) | tadA | 2102902..2103387 (+) | 486 | WP_003226784.1 | tRNA adenosine(34) deaminase TadA | - |
| D9C11_RS11380 (D9C11_11380) | dnaX | 2103864..2105555 (+) | 1692 | WP_069837178.1 | DNA polymerase III subunit gamma/tau | - |
| D9C11_RS11385 (D9C11_11385) | ebfC | 2105579..2105902 (+) | 324 | WP_003225427.1 | YbaB/EbfC family nucleoid-associated protein | - |
| D9C11_RS11390 (D9C11_11390) | recR | 2105917..2106513 (+) | 597 | WP_003225425.1 | recombination protein RecR | - |
| D9C11_RS11395 (D9C11_11395) | yaaL | 2106531..2106755 (+) | 225 | WP_003242387.1 | YaaL family protein | - |
| D9C11_RS11400 (D9C11_11400) | bofA | 2106822..2107085 (+) | 264 | WP_003225421.1 | sigma-K factor-processing regulator BofA | - |
| D9C11_RS11430 (D9C11_11430) | csfB | 2112569..2112763 (+) | 195 | WP_003243294.1 | anti-sigma-G factor | - |
| D9C11_RS11435 (D9C11_11435) | xpaC | 2112883..2113497 (+) | 615 | WP_017696386.1 | 5-bromo-4-chloroindolyl phosphate hydrolysis family protein | - |
| D9C11_RS11440 (D9C11_11440) | yaaN | 2113516..2114676 (+) | 1161 | WP_015715091.1 | toxic anion resistance protein | - |
| D9C11_RS11445 (D9C11_11445) | efpO | 2114758..2116200 (+) | 1443 | WP_121591354.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| D9C11_RS11450 (D9C11_11450) | tmk | 2116197..2116835 (+) | 639 | WP_003243137.1 | dTMP kinase | - |
| D9C11_RS11455 (D9C11_11455) | darA | 2116909..2117238 (+) | 330 | WP_088272133.1 | cyclic di-AMP receptor DarA | - |
| D9C11_RS11460 (D9C11_11460) | yaaR | 2117251..2117691 (+) | 441 | WP_009966249.1 | YaaR family protein | - |
| D9C11_RS11465 (D9C11_11465) | holB | 2117703..2118692 (+) | 990 | WP_088272134.1 | DNA polymerase III subunit delta' | - |
| D9C11_RS11470 (D9C11_11470) | ricT | 2118695..2119522 (+) | 828 | WP_041338386.1 | competence/sporulation regulator complex protein RicT | - |
| D9C11_RS11475 (D9C11_11475) | yabA | 2119537..2119896 (+) | 360 | WP_003218308.1 | replication initiation-control protein YabA | - |
| D9C11_RS11480 (D9C11_11480) | trmNF | 2119955..2120698 (+) | 744 | WP_041338388.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| D9C11_RS11485 (D9C11_11485) | yazA | 2120685..2120984 (+) | 300 | WP_003242983.1 | GIY-YIG nuclease family protein | - |
| D9C11_RS11490 (D9C11_11490) | rsmI | 2120959..2121837 (+) | 879 | WP_003243457.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| D9C11_RS11495 (D9C11_11495) | abrB | 2121886..2122176 (-) | 291 | WP_003226760.1 | transition state genes transcriptional regulator AbrB | Regulator |
| D9C11_RS11500 (D9C11_11500) | metG | 2122671..2124665 (+) | 1995 | WP_121591355.1 | methionine--tRNA ligase | - |
| D9C11_RS11505 (D9C11_11505) | dayD | 2124744..2125511 (+) | 768 | WP_041334230.1 | TatD family hydrolase | - |
| D9C11_RS11510 (D9C11_11510) | yabE | 2125667..2126980 (+) | 1314 | WP_121591356.1 | ubiquitin-like domain-containing protein | - |
| D9C11_RS11515 (D9C11_11515) | rnmV | 2127125..2127685 (+) | 561 | WP_015253010.1 | ribonuclease M5 | - |
| D9C11_RS11520 (D9C11_11520) | rsmA | 2127678..2128556 (+) | 879 | WP_121591357.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| D9C11_RS11525 (D9C11_11525) | prtG | 2128718..2129590 (+) | 873 | WP_043858442.1 | sporulation-specific protease PrtG | - |
| D9C11_RS11530 (D9C11_11530) | veg | 2129801..2130061 (+) | 261 | WP_003218330.1 | biofilm formation stimulator Veg | - |
| D9C11_RS11535 (D9C11_11535) | sspF | 2130221..2130406 (+) | 186 | WP_003218333.1 | small, acid-soluble spore protein, alpha/beta type | - |
| D9C11_RS11540 (D9C11_11540) | ispE | 2130554..2131423 (+) | 870 | WP_003226742.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| D9C11_RS11545 (D9C11_11545) | purR | 2131479..2132336 (+) | 858 | WP_003218342.1 | pur operon repressor | - |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10772.62 Da Isoelectric Point: 6.3482
>NTDB_id=319339 D9C11_RS11495 WP_003226760.1 2121886..2122176(-) (abrB) [Bacillus subtilis subsp. subtilis strain PJ-7]
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK
Nucleotide
Download Length: 291 bp
>NTDB_id=319339 D9C11_RS11495 WP_003226760.1 2121886..2122176(-) (abrB) [Bacillus subtilis subsp. subtilis strain PJ-7]
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTTATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATCTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGATGATAACCTTAAACTTGCAGGCGGTAAATTGGTTCTTAGTAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTTATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATCTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGATGATAACCTTAAACTTGCAGGCGGTAAATTGGTTCTTAGTAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |