Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D9C10_RS14350 Genome accession   NZ_CP032853
Coordinates   2621211..2621351 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain MH-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2616211..2626351
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C10_RS14325 (D9C10_14325) yuxO 2616488..2616868 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  D9C10_RS14330 (D9C10_14330) comA 2616887..2617531 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C10_RS14335 (D9C10_14335) comP 2617612..2619924 (-) 2313 WP_103330147.1 sensor histidine kinase Regulator
  D9C10_RS14340 (D9C10_14340) comX 2619940..2620161 (-) 222 WP_014480704.1 competence pheromone ComX -
  D9C10_RS14345 (D9C10_14345) - 2620163..2621026 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  D9C10_RS14350 (D9C10_14350) degQ 2621211..2621351 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C10_RS14355 (D9C10_14355) - 2621573..2621698 (+) 126 WP_121549029.1 hypothetical protein -
  D9C10_RS14360 (D9C10_14360) - 2621813..2622181 (+) 369 WP_046381300.1 hypothetical protein -
  D9C10_RS14365 (D9C10_14365) pdeH 2622157..2623386 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  D9C10_RS14370 (D9C10_14370) pncB 2623522..2624994 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  D9C10_RS14375 (D9C10_14375) pncA 2625010..2625561 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  D9C10_RS14380 (D9C10_14380) yueI 2625658..2626056 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=319264 D9C10_RS14350 WP_003220708.1 2621211..2621351(-) (degQ) [Bacillus subtilis subsp. subtilis strain MH-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=319264 D9C10_RS14350 WP_003220708.1 2621211..2621351(-) (degQ) [Bacillus subtilis subsp. subtilis strain MH-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment