Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   D9C09_RS17400 Genome accession   NZ_CP032852
Coordinates   3250131..3250541 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis subsp. subtilis strain GFR-12     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3245498..3273403 3250131..3250541 within 0


Gene organization within MGE regions


Location: 3245498..3273403
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C09_RS17375 (D9C09_17375) yqeF 3245665..3246396 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  D9C09_RS17380 (D9C09_17380) cwlH 3246648..3247400 (-) 753 WP_069837642.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  D9C09_RS17385 (D9C09_17385) yqeD 3247587..3248213 (+) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  D9C09_RS17390 (D9C09_17390) gnd 3248232..3249125 (-) 894 WP_069837643.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  D9C09_RS17395 (D9C09_17395) yqeB 3249376..3250098 (+) 723 WP_014480321.1 hypothetical protein -
  D9C09_RS17400 (D9C09_17400) nucA/comI 3250131..3250541 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  D9C09_RS17405 (D9C09_17405) sigK 3250737..3251465 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  D9C09_RS17410 (D9C09_17410) - 3251465..3251563 (+) 99 WP_031600702.1 hypothetical protein -
  D9C09_RS23025 - 3251560..3251772 (-) 213 Protein_3365 recombinase family protein -
  D9C09_RS17420 (D9C09_17420) fumC 3251991..3253379 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  D9C09_RS17425 (D9C09_17425) - 3253546..3254436 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  D9C09_RS17430 (D9C09_17430) - 3255378..3255773 (+) 396 WP_014480327.1 VOC family protein -
  D9C09_RS17440 (D9C09_17440) - 3256513..3257640 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  D9C09_RS23155 (D9C09_17445) - 3257822..3259748 (+) 1927 Protein_3370 T7SS effector LXG polymorphic toxin -
  D9C09_RS17450 (D9C09_17450) - 3259762..3260049 (+) 288 WP_014480331.1 hypothetical protein -
  D9C09_RS17460 (D9C09_17460) - 3260452..3260892 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  D9C09_RS17465 (D9C09_17465) - 3260991..3261443 (+) 453 WP_014480333.1 SMI1/KNR4 family protein -
  D9C09_RS17470 (D9C09_17470) cdiI 3261540..3261899 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  D9C09_RS17475 (D9C09_17475) - 3262004..3262483 (+) 480 WP_224588637.1 hypothetical protein -
  D9C09_RS22585 - 3262787..3262990 (-) 204 WP_123772462.1 hypothetical protein -
  D9C09_RS17480 (D9C09_17480) - 3263070..3263303 (+) 234 WP_224588641.1 hypothetical protein -
  D9C09_RS17485 (D9C09_17485) atxG 3263560..3264137 (+) 578 Protein_3378 suppressor of fused domain protein -
  D9C09_RS17490 (D9C09_17490) - 3264247..3264537 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  D9C09_RS17500 (D9C09_17500) istA 3265378..3266925 (+) 1548 WP_014480339.1 IS21 family transposase -
  D9C09_RS17505 (D9C09_17505) istB 3266922..3267680 (+) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  D9C09_RS23045 - 3267998..3268095 (-) 98 Protein_3382 N-acetylmuramoyl-L-alanine amidase -
  D9C09_RS17515 (D9C09_17515) - 3268300..3268359 (+) 60 WP_076458313.1 putative holin-like toxin -
  D9C09_RS23255 (D9C09_17520) - 3268646..3269082 (-) 437 Protein_3384 phage tail tube protein -
  D9C09_RS22720 terS 3269080..3269645 (-) 566 Protein_3385 phage terminase small subunit -
  D9C09_RS22590 - 3269772..3270077 (+) 306 WP_123772463.1 hypothetical protein -
  D9C09_RS23060 - 3270250..3270315 (-) 66 Protein_3387 hypothetical protein -
  D9C09_RS17530 (D9C09_17530) - 3270470..3270949 (-) 480 WP_014480344.1 hypothetical protein -
  D9C09_RS17535 (D9C09_17535) - 3271566..3271832 (+) 267 WP_033881358.1 hypothetical protein -
  D9C09_RS17540 (D9C09_17540) - 3271971..3272123 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  D9C09_RS17545 (D9C09_17545) - 3272206..3272328 (-) 123 Protein_3391 RusA family crossover junction endodeoxyribonuclease -
  D9C09_RS17550 (D9C09_17550) - 3272291..3272539 (-) 249 Protein_3392 hypothetical protein -
  D9C09_RS23065 - 3272684..3272914 (-) 231 WP_224588644.1 hypothetical protein -
  D9C09_RS17560 (D9C09_17560) - 3273223..3273403 (-) 181 Protein_3394 hypothetical protein -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=319200 D9C09_RS17400 WP_009967785.1 3250131..3250541(-) (nucA/comI) [Bacillus subtilis subsp. subtilis strain GFR-12]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=319200 D9C09_RS17400 WP_009967785.1 3250131..3250541(-) (nucA/comI) [Bacillus subtilis subsp. subtilis strain GFR-12]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment