Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   D8Z68_RS19455 Genome accession   NZ_CP032808
Coordinates   3662644..3663273 (-) Length   209 a.a.
NCBI ID   WP_000839159.1    Uniprot ID   A0AAV3HCB2
Organism   Escherichia coli strain ERL04-3476     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3645651..3674447 3662644..3663273 within 0


Gene organization within MGE regions


Location: 3645651..3674447
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D8Z68_RS19360 (D8Z68_19700) - 3647002..3647391 (+) 390 WP_000394511.1 hypothetical protein -
  D8Z68_RS19365 (D8Z68_19705) - 3647578..3647763 (-) 186 WP_001133046.1 hypothetical protein -
  D8Z68_RS19375 (D8Z68_19715) dicB 3648337..3648525 (+) 189 WP_000413705.1 cell division inhibition protein DicB -
  D8Z68_RS19380 (D8Z68_19720) - 3648522..3648713 (+) 192 WP_001098307.1 DUF1482 family protein -
  D8Z68_RS19385 (D8Z68_19725) - 3648807..3651278 (+) 2472 WP_103656106.1 exonuclease -
  D8Z68_RS19390 (D8Z68_19730) - 3651346..3651588 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  D8Z68_RS19395 (D8Z68_19735) - 3651566..3652585 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  D8Z68_RS19400 (D8Z68_19745) yccA 3652993..3653652 (+) 660 WP_000375128.1 FtsH protease modulator YccA -
  D8Z68_RS19405 (D8Z68_19750) tusE 3653743..3654072 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  D8Z68_RS19410 (D8Z68_19755) yccX 3654069..3654347 (-) 279 WP_000048252.1 acylphosphatase -
  D8Z68_RS19415 (D8Z68_19760) rlmI 3654442..3655632 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  D8Z68_RS19420 (D8Z68_19765) hspQ 3655690..3656007 (+) 318 WP_001295356.1 heat shock protein HspQ -
  D8Z68_RS19425 (D8Z68_19770) yccU 3656052..3656465 (-) 414 WP_000665217.1 CoA-binding protein -
  D8Z68_RS19430 (D8Z68_19775) yccT 3656638..3657300 (+) 663 WP_000847791.1 DUF2057 family protein -
  D8Z68_RS19435 (D8Z68_19780) mgsA 3657396..3657854 (+) 459 WP_000424181.1 methylglyoxal synthase -
  D8Z68_RS19440 (D8Z68_19785) helD 3657886..3659940 (-) 2055 WP_001301436.1 DNA helicase IV -
  D8Z68_RS19445 (D8Z68_19790) yccF 3660063..3660509 (+) 447 WP_001261230.1 YccF domain-containing protein -
  D8Z68_RS19450 (D8Z68_19795) yccS 3660519..3662681 (+) 2163 WP_000875023.1 YccS family putative transporter -
  D8Z68_RS19455 (D8Z68_19800) sxy/tfoX 3662644..3663273 (-) 630 WP_000839159.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  D8Z68_RS19460 (D8Z68_19805) sulA 3663492..3664001 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  D8Z68_RS19465 (D8Z68_19810) ompA 3664358..3665398 (+) 1041 WP_000750416.1 porin OmpA -
  D8Z68_RS19470 (D8Z68_19815) matP 3665474..3665926 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  D8Z68_RS19475 (D8Z68_19820) ycbZ 3666112..3667872 (+) 1761 WP_000156526.1 Lon protease family protein -
  D8Z68_RS19480 (D8Z68_19825) fabA 3667941..3668459 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  D8Z68_RS19485 (D8Z68_19830) rmf 3668529..3668696 (-) 168 WP_000828648.1 ribosome modulation factor -
  D8Z68_RS19490 (D8Z68_19835) pqiC 3668952..3669515 (-) 564 WP_000759107.1 membrane integrity-associated transporter subunit PqiC -
  D8Z68_RS19495 (D8Z68_19840) pqiB 3669512..3671152 (-) 1641 WP_000445550.1 intermembrane transport protein PqiB -
  D8Z68_RS19500 (D8Z68_19845) pqiA 3671157..3672410 (-) 1254 WP_000333170.1 membrane integrity-associated transporter subunit PqiA -
  D8Z68_RS19505 (D8Z68_19850) uup 3672540..3674447 (-) 1908 WP_000053083.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24173.05 Da        Isoelectric Point: 9.1942

>NTDB_id=318833 D8Z68_RS19455 WP_000839159.1 3662644..3663273(-) (sxy/tfoX) [Escherichia coli strain ERL04-3476]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKYPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=318833 D8Z68_RS19455 WP_000839159.1 3662644..3663273(-) (sxy/tfoX) [Escherichia coli strain ERL04-3476]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAATATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment