Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   D7J84_RS25800 Genome accession   NZ_CP032608
Coordinates   5010233..5010511 (-) Length   92 a.a.
NCBI ID   WP_061884209.1    Uniprot ID   A0A9W3YKH5
Organism   Bacillus thuringiensis strain QZL38     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4976830..5019895 5010233..5010511 within 0


Gene organization within MGE regions


Location: 4976830..5019895
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D7J84_RS25600 (D7J84_25640) - 4976830..4977648 (-) 819 WP_061884229.1 GH25 family lysozyme -
  D7J84_RS25605 (D7J84_25645) - 4977665..4977895 (-) 231 WP_000792698.1 phage holin -
  D7J84_RS25610 (D7J84_25650) - 4977938..4978177 (-) 240 WP_061884228.1 hemolysin XhlA family protein -
  D7J84_RS25615 (D7J84_25655) - 4978258..4979439 (-) 1182 WP_061884227.1 BppU family phage baseplate upper protein -
  D7J84_RS25620 (D7J84_25660) - 4979454..4981859 (-) 2406 WP_061884226.1 phage tail spike protein -
  D7J84_RS25625 (D7J84_25665) - 4981859..4982542 (-) 684 WP_061884225.1 phage tail domain-containing protein -
  D7J84_RS25630 (D7J84_25670) - 4982544..4985384 (-) 2841 WP_231122445.1 hypothetical protein -
  D7J84_RS25635 (D7J84_25675) - 4985602..4987434 (-) 1833 WP_061884224.1 hypothetical protein -
  D7J84_RS25640 (D7J84_25680) - 4987613..4988074 (-) 462 WP_000867964.1 hypothetical protein -
  D7J84_RS25645 (D7J84_25685) - 4988146..4988730 (-) 585 WP_021727578.1 major tail protein B -
  D7J84_RS25650 (D7J84_25690) - 4988731..4989159 (-) 429 WP_081113953.1 hypothetical protein -
  D7J84_RS25655 (D7J84_25695) - 4989146..4989547 (-) 402 WP_021727580.1 hypothetical protein -
  D7J84_RS25660 (D7J84_25700) - 4989540..4989896 (-) 357 WP_061884223.1 phage head closure protein -
  D7J84_RS25665 (D7J84_25705) - 4989886..4990173 (-) 288 WP_033693053.1 hypothetical protein -
  D7J84_RS25670 (D7J84_25710) - 4990314..4991477 (-) 1164 WP_046946241.1 phage major capsid protein -
  D7J84_RS25675 (D7J84_25715) - 4991520..4992236 (-) 717 WP_061884222.1 head maturation protease, ClpP-related -
  D7J84_RS25680 (D7J84_25720) - 4992217..4993389 (-) 1173 WP_061884221.1 phage portal protein -
  D7J84_RS25685 (D7J84_25725) - 4993404..4995083 (-) 1680 WP_000178388.1 terminase TerL endonuclease subunit -
  D7J84_RS25690 (D7J84_25730) - 4995067..4995387 (-) 321 WP_001170969.1 P27 family phage terminase small subunit -
  D7J84_RS25695 (D7J84_25735) - 4995496..4995804 (-) 309 WP_000587659.1 hypothetical protein -
  D7J84_RS32740 (D7J84_25740) - 4995807..4996076 (-) 270 WP_002164449.1 HNH endonuclease signature motif containing protein -
  D7J84_RS25705 (D7J84_25745) - 4996115..4996360 (-) 246 WP_000676190.1 hypothetical protein -
  D7J84_RS25715 (D7J84_25755) - 4996552..4996776 (-) 225 WP_000422427.1 hypothetical protein -
  D7J84_RS25720 (D7J84_25760) - 4996824..4997021 (-) 198 WP_001054638.1 hypothetical protein -
  D7J84_RS25725 (D7J84_25765) - 4997062..4997274 (-) 213 WP_000453545.1 DNA translocase FtsK -
  D7J84_RS25730 (D7J84_25770) - 4997906..4998448 (-) 543 WP_061884220.1 tyrosine-type recombinase/integrase -
  D7J84_RS25735 (D7J84_25775) - 4998445..4998915 (-) 471 WP_061884219.1 ArpU family phage packaging/lysis transcriptional regulator -
  D7J84_RS32745 - 4998936..4999106 (-) 171 WP_000866143.1 hypothetical protein -
  D7J84_RS25740 (D7J84_25780) - 4999235..4999417 (-) 183 WP_061884218.1 hypothetical protein -
  D7J84_RS25745 (D7J84_25785) - 5000983..5001714 (+) 732 WP_061884217.1 hypothetical protein -
  D7J84_RS25750 (D7J84_25790) - 5001906..5002370 (+) 465 WP_001109248.1 hypothetical protein -
  D7J84_RS25755 (D7J84_25795) - 5002552..5002806 (-) 255 WP_061884216.1 hypothetical protein -
  D7J84_RS25760 (D7J84_25800) - 5003125..5004450 (-) 1326 WP_061884215.1 exosporium glycoprotein BclB-related protein -
  D7J84_RS25765 (D7J84_25805) - 5005703..5006266 (+) 564 WP_231122444.1 complement C1q domain-containing protein -
  D7J84_RS25770 (D7J84_25810) - 5006949..5007650 (+) 702 WP_129542622.1 exosporium leader peptide-containing protein -
  D7J84_RS25775 (D7J84_25815) - 5007938..5008801 (+) 864 WP_061884213.1 hypothetical protein -
  D7J84_RS25780 (D7J84_25820) - 5008915..5009397 (-) 483 WP_061884212.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  D7J84_RS25785 (D7J84_25825) - 5009418..5009669 (-) 252 WP_061884211.1 hypothetical protein -
  D7J84_RS25790 (D7J84_25830) - 5009695..5009862 (-) 168 WP_000754942.1 DUF3954 domain-containing protein -
  D7J84_RS25795 (D7J84_25835) - 5009881..5010240 (-) 360 WP_061884210.1 hypothetical protein -
  D7J84_RS25800 (D7J84_25840) abrB 5010233..5010511 (-) 279 WP_061884209.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  D7J84_RS25805 (D7J84_25845) - 5010515..5011522 (-) 1008 WP_102947867.1 DnaD domain protein -
  D7J84_RS32750 - 5011743..5011898 (-) 156 WP_081113949.1 hypothetical protein -
  D7J84_RS25810 (D7J84_25850) - 5011898..5012164 (-) 267 WP_000522182.1 helix-turn-helix domain-containing protein -
  D7J84_RS25815 (D7J84_25855) - 5012205..5012429 (-) 225 WP_061884207.1 helix-turn-helix transcriptional regulator -
  D7J84_RS25820 (D7J84_25860) - 5012609..5012959 (+) 351 WP_061884206.1 helix-turn-helix transcriptional regulator -
  D7J84_RS32755 - 5013223..5013378 (-) 156 WP_165375022.1 hypothetical protein -
  D7J84_RS25825 (D7J84_25865) - 5013405..5014613 (-) 1209 WP_061884204.1 AimR family lysis-lysogeny pheromone receptor -
  D7J84_RS25830 (D7J84_25870) - 5015211..5016320 (+) 1110 WP_061884203.1 tyrosine-type recombinase/integrase -
  D7J84_RS25835 (D7J84_25875) - 5016358..5017059 (-) 702 WP_061884202.1 DUF3962 domain-containing protein -
  D7J84_RS25840 (D7J84_25880) - 5017369..5017854 (-) 486 WP_002164034.1 hypothetical protein -
  D7J84_RS25845 (D7J84_25885) - 5018062..5018196 (-) 135 Protein_4991 site-specific integrase -
  D7J84_RS25850 (D7J84_25890) - 5018545..5018808 (-) 264 WP_002082716.1 DUF3937 domain-containing protein -
  D7J84_RS25860 (D7J84_25900) tenA 5019206..5019895 (-) 690 WP_061884201.1 thiaminase II -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10211.89 Da        Isoelectric Point: 5.1799

>NTDB_id=317034 D7J84_RS25800 WP_061884209.1 5010233..5010511(-) (abrB) [Bacillus thuringiensis strain QZL38]
MKNIGVARKVEELGRVVIPVELRRTLGIVEGTALDFHVEGENIVLRKYEKSCFVTGEVSETNIELLDGRMFLSKEGAIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=317034 D7J84_RS25800 WP_061884209.1 5010233..5010511(-) (abrB) [Bacillus thuringiensis strain QZL38]
ATGAAAAACATAGGTGTTGCAAGAAAAGTGGAAGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTTGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGATGGGCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.322

94.565

0.533

Multiple sequence alignment