Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   D6022_RS08485 Genome accession   NZ_CP032538
Coordinates   1656461..1656601 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain MT-B06     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1651461..1661601
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D6022_RS08455 - 1651562..1651963 (+) 402 WP_003184870.1 YueI family protein -
  D6022_RS08460 - 1652148..1652699 (+) 552 WP_003184868.1 cysteine hydrolase family protein -
  D6022_RS08465 - 1652717..1654186 (+) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  D6022_RS08470 - 1654365..1655585 (+) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  D6022_RS08475 - 1655628..1655975 (-) 348 WP_009329512.1 hypothetical protein -
  D6022_RS08485 degQ 1656461..1656601 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  D6022_RS08490 - 1656790..1657659 (+) 870 WP_011198252.1 polyprenyl synthetase family protein -
  D6022_RS08495 comX 1657674..1657838 (+) 165 WP_011198251.1 competence pheromone ComX -
  D6022_RS08500 comP 1657878..1660199 (+) 2322 WP_026080865.1 ATP-binding protein Regulator
  D6022_RS08505 comA 1660286..1660924 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  D6022_RS08510 - 1660941..1661330 (+) 390 WP_003184847.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=316828 D6022_RS08485 WP_003184860.1 1656461..1656601(+) (degQ) [Bacillus licheniformis strain MT-B06]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=316828 D6022_RS08485 WP_003184860.1 1656461..1656601(+) (degQ) [Bacillus licheniformis strain MT-B06]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment