Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4L66_RS07190 Genome accession   NZ_CP032471
Coordinates   1483213..1483326 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 479-C2-EK2     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1478213..1488326
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4L66_RS07170 - 1478882..1480294 (-) 1413 WP_139518910.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4L66_RS07175 comB10 1480364..1481500 (-) 1137 WP_139518911.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4L66_RS07180 comB9 1481493..1482473 (-) 981 WP_139518912.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4L66_RS07185 comB8 1482473..1483216 (-) 744 WP_100959825.1 virB8 family protein Machinery gene
  D4L66_RS07190 comB7 1483213..1483326 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4L66_RS07195 comB6 1483342..1484397 (-) 1056 WP_139518913.1 P-type conjugative transfer protein TrbL Machinery gene
  D4L66_RS07200 - 1484405..1485400 (-) 996 WP_139519045.1 PDZ domain-containing protein -
  D4L66_RS07205 - 1485400..1485702 (-) 303 WP_139518914.1 YbaB/EbfC family nucleoid-associated protein -
  D4L66_RS07210 panD 1485714..1486064 (-) 351 WP_108310021.1 aspartate 1-decarboxylase -
  D4L66_RS07215 - 1486054..1488279 (-) 2226 WP_139518915.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=316139 D4L66_RS07190 WP_001217873.1 1483213..1483326(-) (comB7) [Helicobacter pylori strain 479-C2-EK2]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=316139 D4L66_RS07190 WP_001217873.1 1483213..1483326(-) (comB7) [Helicobacter pylori strain 479-C2-EK2]
ATAAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment