Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLW34_RS11705 | Genome accession | NZ_CP032430 |
| Coordinates | 2252016..2252315 (-) | Length | 99 a.a. |
| NCBI ID | WP_011677181.1 | Uniprot ID | A0AA47KWG7 |
| Organism | Lactococcus cremoris strain W34 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2240050..2278419 | 2252016..2252315 | within | 0 |
| IScluster/Tn | 2247292..2254494 | 2252016..2252315 | within | 0 |
Gene organization within MGE regions
Location: 2240050..2278419
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLW34_RS11650 (LLW34_2275) | - | 2240234..2242051 (-) | 1818 | WP_011677169.1 | acyltransferase family protein | - |
| LLW34_RS11655 (LLW34_2276) | - | 2242153..2244384 (-) | 2232 | WP_011677170.1 | PBP1A family penicillin-binding protein | - |
| LLW34_RS11660 (LLW34_2277) | - | 2244770..2245405 (-) | 636 | WP_011677171.1 | DUF421 domain-containing protein | - |
| LLW34_RS11665 (LLW34_2278) | - | 2245423..2245854 (-) | 432 | WP_011677172.1 | DUF3290 domain-containing protein | - |
| LLW34_RS11670 (LLW34_03455) | - | 2245969..2246346 (-) | 378 | Protein_2270 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LLW34_RS11675 (LLW34_2280) | - | 2246540..2247412 (+) | 873 | WP_014573331.1 | RluA family pseudouridine synthase | - |
| LLW34_RS11685 (LLW34_2283) | - | 2248942..2249751 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLW34_RS11690 (LLW34_2284) | - | 2249744..2250481 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLW34_RS11695 (LLW34_2285) | - | 2250660..2251502 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLW34_RS11700 (LLW34_2286) | - | 2251499..2251936 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLW34_RS11705 (LLW34_03465) | comGG | 2252016..2252315 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLW34_RS11710 (LLW34_2287) | comGF | 2252339..2252602 (-) | 264 | WP_021211201.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLW34_RS11715 (LLW34_2288) | istB | 2252685..2253443 (-) | 759 | WP_205288058.1 | IS21-like element helper ATPase IstB | - |
| LLW34_RS11720 (LLW34_2289) | istA | 2253455..2254678 (-) | 1224 | WP_003331415.1 | IS21-like element IS712 family transposase | - |
| LLW34_RS11725 (LLW34_03470) | - | 2254734..2254856 (-) | 123 | WP_021211203.1 | hypothetical protein | - |
| LLW34_RS11730 (LLW34_2290) | - | 2254849..2255259 (-) | 411 | WP_011676523.1 | terminase | - |
| LLW34_RS11735 (LLW34_2291) | - | 2255701..2256123 (-) | 423 | WP_014573151.1 | RinA family protein | - |
| LLW34_RS11740 (LLW34_2292) | - | 2256201..2256509 (-) | 309 | WP_021211204.1 | hypothetical protein | - |
| LLW34_RS11745 (LLW34_2293) | - | 2256760..2257098 (-) | 339 | WP_021211205.1 | DUF1140 family protein | - |
| LLW34_RS11750 (LLW34_2294) | - | 2257099..2257518 (-) | 420 | WP_205288143.1 | dUTP diphosphatase | - |
| LLW34_RS11755 (LLW34_2295) | - | 2257515..2258078 (-) | 564 | WP_242515028.1 | DUF1642 domain-containing protein | - |
| LLW34_RS11760 (LLW34_2296) | - | 2258071..2258277 (-) | 207 | WP_011676933.1 | DUF1125 domain-containing protein | - |
| LLW34_RS11765 (LLW34_2297) | - | 2258291..2258815 (-) | 525 | WP_205288144.1 | hypothetical protein | - |
| LLW34_RS11770 (LLW34_2298) | - | 2258921..2259160 (-) | 240 | WP_021211207.1 | DUF1031 domain-containing protein | - |
| LLW34_RS11775 (LLW34_2299) | - | 2259161..2259580 (-) | 420 | WP_205288145.1 | hypothetical protein | - |
| LLW34_RS11780 (LLW34_2300) | - | 2259570..2259791 (-) | 222 | WP_021211208.1 | hypothetical protein | - |
| LLW34_RS11785 (LLW34_2301) | - | 2259772..2260581 (-) | 810 | WP_021211209.1 | helix-turn-helix domain-containing protein | - |
| LLW34_RS11790 (LLW34_2302) | - | 2260808..2261875 (-) | 1068 | WP_021212298.1 | DUF1351 domain-containing protein | - |
| LLW34_RS11795 (LLW34_2303) | bet | 2261877..2262614 (-) | 738 | WP_021211211.1 | phage recombination protein Bet | - |
| LLW34_RS11800 (LLW34_2304) | - | 2262736..2262951 (-) | 216 | WP_010905687.1 | DUF1408 domain-containing protein | - |
| LLW34_RS11805 (LLW34_2305) | - | 2263054..2263332 (+) | 279 | WP_205288146.1 | hypothetical protein | - |
| LLW34_RS11810 (LLW34_2306) | - | 2263287..2263520 (-) | 234 | WP_205288147.1 | hypothetical protein | - |
| LLW34_RS11815 | - | 2263658..2263852 (-) | 195 | WP_015966881.1 | hypothetical protein | - |
| LLW34_RS11820 (LLW34_2308) | - | 2263865..2264608 (-) | 744 | WP_031298611.1 | ORF6C domain-containing protein | - |
| LLW34_RS11825 (LLW34_2309) | - | 2264623..2264853 (-) | 231 | WP_011676017.1 | hypothetical protein | - |
| LLW34_RS11830 (LLW34_2310) | - | 2265143..2265490 (+) | 348 | WP_031298613.1 | XRE family transcriptional regulator | - |
| LLW34_RS11835 (LLW34_2311) | - | 2265519..2266082 (+) | 564 | WP_021211213.1 | hypothetical protein | - |
| LLW34_RS11840 (LLW34_2312) | - | 2266094..2266294 (+) | 201 | WP_021211214.1 | hypothetical protein | - |
| LLW34_RS11845 (LLW34_2313) | - | 2266370..2266807 (+) | 438 | WP_205288148.1 | DUF6978 family protein | - |
| LLW34_RS11850 (LLW34_2314) | - | 2266833..2267624 (+) | 792 | WP_205288149.1 | DUF1829 domain-containing protein | - |
| LLW34_RS11855 (LLW34_2315) | - | 2267742..2269199 (+) | 1458 | WP_205288150.1 | recombinase family protein | - |
| LLW34_RS11860 (LLW34_2316) | comGC | 2269196..2269330 (-) | 135 | WP_021211216.1 | hypothetical protein | Machinery gene |
| LLW34_RS11865 (LLW34_2317) | comGB | 2269348..2269797 (-) | 450 | WP_332375395.1 | type II secretion system F family protein | Machinery gene |
| LLW34_RS11870 (LLW34_2318) | - | 2269894..2271069 (+) | 1176 | WP_003138385.1 | IS256-like element IS905 family transposase | - |
| LLW34_RS11875 (LLW34_2319) | comGB | 2271116..2271601 (-) | 486 | WP_242515029.1 | type II secretion system F family protein | Machinery gene |
| LLW34_RS11880 (LLW34_2320) | - | 2271594..2272415 (-) | 822 | Protein_2312 | ATPase, T2SS/T4P/T4SS family | - |
| LLW34_RS11885 (LLW34_2321) | - | 2272518..2273408 (+) | 891 | WP_205288151.1 | IS982-like element IS982B family transposase | - |
| LLW34_RS11890 (LLW34_2322) | comGA | 2273390..2273581 (-) | 192 | WP_242515031.1 | hypothetical protein | Machinery gene |
| LLW34_RS11895 (LLW34_2323) | - | 2273696..2277526 (-) | 3831 | Protein_2315 | PolC-type DNA polymerase III | - |
Sequence
Protein
Download Length: 99 a.a. Molecular weight: 11240.23 Da Isoelectric Point: 9.5415
>NTDB_id=315833 LLW34_RS11705 WP_011677181.1 2252016..2252315(-) (comGG) [Lactococcus cremoris strain W34]
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSN
KTYCFDVRLKDGRIFQIVK
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSN
KTYCFDVRLKDGRIFQIVK
Nucleotide
Download Length: 300 bp
>NTDB_id=315833 LLW34_RS11705 WP_011677181.1 2252016..2252315(-) (comGG) [Lactococcus cremoris strain W34]
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTTTCAAATAGTAAAGTAA
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTTTCAAATAGTAAAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
98.99 |
100 |
0.99 |