Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   D3873_RS08900 Genome accession   NZ_CP032418
Coordinates   1741834..1742034 (-) Length   66 a.a.
NCBI ID   WP_420798987.1    Uniprot ID   -
Organism   Paenisporosarcina cavernae strain K2R23-3     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Genomic Context


Location: 1736834..1747034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D3873_RS08875 (D3873_08875) - 1736893..1737615 (+) 723 WP_119883717.1 hypothetical protein -
  D3873_RS13635 - 1738224..1738349 (-) 126 WP_274379949.1 hypothetical protein -
  D3873_RS08880 (D3873_08880) - 1738887..1739192 (-) 306 WP_205536255.1 hypothetical protein -
  D3873_RS08885 (D3873_08885) - 1739177..1740769 (-) 1593 WP_162920173.1 RHS repeat-associated core domain-containing protein -
  D3873_RS08890 (D3873_08890) - 1740857..1741042 (+) 186 WP_119884518.1 helix-turn-helix domain-containing protein -
  D3873_RS08895 (D3873_08895) comJ 1741351..1741818 (-) 468 WP_119883719.1 competence protein ComJ -
  D3873_RS08900 (D3873_08900) nucA/comI 1741834..1742034 (-) 201 WP_420798987.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  D3873_RS08905 (D3873_08905) - 1742215..1743453 (-) 1239 WP_119883721.1 IS110 family transposase -
  D3873_RS08910 (D3873_08910) - 1743632..1744378 (-) 747 WP_119883722.1 recombinase family protein -
  D3873_RS08915 (D3873_08915) - 1744995..1745282 (-) 288 WP_119883723.1 hypothetical protein -
  D3873_RS08925 (D3873_08925) - 1745686..1745928 (-) 243 Protein_1733 IS110 family transposase -
  D3873_RS08930 (D3873_08930) - 1745972..1746511 (-) 540 WP_119883724.1 RNA 2'-phosphotransferase -
  D3873_RS08935 (D3873_08935) - 1746559..1746927 (-) 369 WP_119883725.1 hypothetical protein -

Sequence


Protein


Download         Length: 66 a.a.        Molecular weight: 7108.10 Da        Isoelectric Point: 10.4547

>NTDB_id=315683 D3873_RS08900 WP_420798987.1 1741834..1742034(-) (nucA/comI) [Paenisporosarcina cavernae strain K2R23-3]
MRRKDSLGGLNKVPGKDLDEYPPAMFKEGGMGASVRPVSPSDNRGAGAYLGNKLRNYPDGTTVRLK

Nucleotide


Download         Length: 201 bp        

>NTDB_id=315683 D3873_RS08900 WP_420798987.1 1741834..1742034(-) (nucA/comI) [Paenisporosarcina cavernae strain K2R23-3]
TTGCGAAGAAAAGATAGCTTAGGTGGTCTTAATAAAGTTCCAGGAAAGGATTTAGATGAATACCCACCAGCAATGTTTAA
AGAGGGTGGTATGGGTGCAAGTGTAAGACCTGTTAGTCCATCTGATAACAGAGGTGCAGGTGCTTATTTGGGGAATAAGT
TAAGAAATTATCCAGATGGAACGACAGTAAGACTGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

56.452

93.939

0.53


Multiple sequence alignment