Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D3Z87_RS17370 Genome accession   NZ_CP032310
Coordinates   3256716..3256856 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain WB800N     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251716..3261856
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D3Z87_RS17345 (D3Z87_17185) yuxO 3252029..3252409 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  D3Z87_RS17350 (D3Z87_17190) comA 3252428..3253072 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D3Z87_RS17355 (D3Z87_17195) comP 3253153..3255462 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  D3Z87_RS17360 (D3Z87_17200) comX 3255477..3255644 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  D3Z87_RS17365 (D3Z87_17205) comQ 3255632..3256531 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  D3Z87_RS17370 (D3Z87_17210) degQ 3256716..3256856 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D3Z87_RS17375 - 3257078..3257203 (+) 126 WP_003228793.1 hypothetical protein -
  D3Z87_RS17380 (D3Z87_17215) - 3257317..3257685 (+) 369 WP_003243784.1 hypothetical protein -
  D3Z87_RS17385 (D3Z87_17220) pdeH 3257661..3258890 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  D3Z87_RS17390 (D3Z87_17225) pncB 3259027..3260499 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  D3Z87_RS17395 (D3Z87_17230) pncA 3260515..3261066 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  D3Z87_RS17400 (D3Z87_17235) yueI 3261163..3261561 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=314922 D3Z87_RS17370 WP_003220708.1 3256716..3256856(-) (degQ) [Bacillus subtilis strain WB800N]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=314922 D3Z87_RS17370 WP_003220708.1 3256716..3256856(-) (degQ) [Bacillus subtilis strain WB800N]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment