Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | D3Z87_RS14045 | Genome accession | NZ_CP032310 |
| Coordinates | 2652014..2652424 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain WB800N | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2647380..2698870 | 2652014..2652424 | within | 0 |
Gene organization within MGE regions
Location: 2647380..2698870
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D3Z87_RS14020 (D3Z87_13930) | yqeF | 2647547..2648278 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| D3Z87_RS14025 (D3Z87_13935) | cwlH | 2648530..2649282 (-) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| D3Z87_RS14030 (D3Z87_13940) | yqeD | 2649469..2650095 (+) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| D3Z87_RS14035 (D3Z87_13945) | gnd | 2650114..2651007 (-) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| D3Z87_RS14040 (D3Z87_13950) | yqeB | 2651259..2651981 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| D3Z87_RS14045 (D3Z87_13955) | nucA/comI | 2652014..2652424 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| D3Z87_RS14050 (D3Z87_13960) | - | 2652620..2652967 (+) | 348 | Protein_2714 | sigma-70 family RNA polymerase sigma factor | - |
| D3Z87_RS14055 (D3Z87_13965) | spoIVCA | 2652998..2654458 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| D3Z87_RS22520 (D3Z87_13970) | - | 2654416..2654594 (-) | 179 | Protein_2716 | hypothetical protein | - |
| D3Z87_RS14065 (D3Z87_13975) | arsC | 2654949..2655368 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| D3Z87_RS14070 (D3Z87_13980) | acr3 | 2655380..2656420 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| D3Z87_RS14075 (D3Z87_13985) | arsK | 2656443..2656883 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| D3Z87_RS14080 (D3Z87_13990) | arsR | 2656944..2657261 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| D3Z87_RS14085 (D3Z87_13995) | yqcI | 2657633..2658397 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| D3Z87_RS14090 (D3Z87_14000) | rapE | 2658840..2659967 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| D3Z87_RS14095 (D3Z87_14005) | phrE | 2659957..2660091 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| D3Z87_RS14100 (D3Z87_14010) | - | 2660201..2660359 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| D3Z87_RS14105 (D3Z87_14015) | yqcG | 2660729..2662324 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| D3Z87_RS14110 (D3Z87_14020) | yqcF | 2662339..2662917 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| D3Z87_RS14115 | - | 2663035..2663181 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| D3Z87_RS14120 (D3Z87_14025) | - | 2663178..2663540 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| D3Z87_RS14125 (D3Z87_14030) | - | 2663556..2664035 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| D3Z87_RS14130 (D3Z87_14035) | cwlA | 2664200..2665018 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| D3Z87_RS14135 (D3Z87_14040) | skhD | 2665063..2665485 (-) | 423 | WP_003246208.1 | holin family protein | - |
| D3Z87_RS14140 (D3Z87_14045) | xepAK | 2665530..2666423 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| D3Z87_RS14145 (D3Z87_14050) | yqcE | 2666511..2666675 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| D3Z87_RS14150 (D3Z87_14055) | yqcD | 2666672..2667007 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| D3Z87_RS14155 (D3Z87_14060) | yqcC | 2667017..2668117 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| D3Z87_RS14160 (D3Z87_14065) | - | 2668120..2668392 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| D3Z87_RS14165 (D3Z87_14070) | yqcA | 2668389..2668967 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| D3Z87_RS14170 (D3Z87_14075) | yqbT | 2668951..2669997 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| D3Z87_RS14175 (D3Z87_14080) | yqbS | 2669990..2670415 (-) | 426 | WP_045147880.1 | DUF2634 domain-containing protein | - |
| D3Z87_RS14180 (D3Z87_14085) | yqbR | 2670428..2670691 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| D3Z87_RS14185 (D3Z87_14090) | yqbQ | 2670688..2671668 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| D3Z87_RS14190 (D3Z87_14095) | yqbP | 2671681..2672340 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| D3Z87_RS14195 (D3Z87_14100) | yqbO | 2672333..2677090 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| D3Z87_RS14200 (D3Z87_14105) | - | 2677093..2677230 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| D3Z87_RS14205 (D3Z87_14110) | - | 2677272..2677721 (-) | 450 | WP_003229933.1 | phage portal protein | - |
| D3Z87_RS14210 (D3Z87_14115) | txpA | 2677867..2678046 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| D3Z87_RS14215 (D3Z87_14120) | bsrH | 2678426..2678515 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| D3Z87_RS14220 (D3Z87_14125) | yqbM | 2678769..2679212 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| D3Z87_RS14225 (D3Z87_14130) | yqbK | 2679215..2680615 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| D3Z87_RS14230 (D3Z87_14135) | - | 2680616..2680807 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| D3Z87_RS14235 (D3Z87_14140) | yqbJ | 2680804..2681241 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| D3Z87_RS14240 (D3Z87_14145) | yqbI | 2681254..2681757 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| D3Z87_RS14245 (D3Z87_14150) | yqbH | 2681754..2682116 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| D3Z87_RS14250 (D3Z87_14155) | gkpG | 2682113..2682508 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| D3Z87_RS14255 (D3Z87_14160) | yqbF | 2682512..2682823 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| D3Z87_RS14260 (D3Z87_14165) | skdG | 2682834..2683769 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| D3Z87_RS14265 (D3Z87_14170) | yqbD | 2683788..2684756 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| D3Z87_RS14270 (D3Z87_14175) | - | 2684789..2685442 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| D3Z87_RS14275 (D3Z87_14180) | yqbB | 2685483..2686400 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| D3Z87_RS14280 (D3Z87_14185) | yqbA | 2686397..2687929 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| D3Z87_RS14285 (D3Z87_14190) | stmB | 2687933..2689228 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| D3Z87_RS14290 (D3Z87_14195) | terS | 2689221..2689940 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| D3Z87_RS14295 (D3Z87_14200) | - | 2690008..2690472 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| D3Z87_RS14300 (D3Z87_14205) | yqaQ | 2690616..2691071 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| D3Z87_RS14305 (D3Z87_14210) | - | 2691269..2692198 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| D3Z87_RS14310 (D3Z87_14215) | yqaO | 2692272..2692478 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| D3Z87_RS14315 (D3Z87_14220) | yqaN | 2692560..2692988 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| D3Z87_RS14320 (D3Z87_14225) | - | 2693084..2693233 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| D3Z87_RS14325 (D3Z87_14230) | sknM | 2693224..2694165 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| D3Z87_RS14330 (D3Z87_14235) | yqaL | 2694047..2694724 (-) | 678 | WP_010886575.1 | DnaD domain protein | - |
| D3Z87_RS14335 (D3Z87_14240) | recT | 2694800..2695654 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| D3Z87_RS14340 (D3Z87_14245) | yqaJ | 2695657..2696616 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| D3Z87_RS14345 (D3Z87_14250) | - | 2696722..2696916 (-) | 195 | WP_003229905.1 | hypothetical protein | - |
| D3Z87_RS14350 | - | 2696876..2697049 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| D3Z87_RS14355 (D3Z87_14255) | sknH | 2697046..2697303 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| D3Z87_RS14360 (D3Z87_14260) | yqaG | 2697300..2697869 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| D3Z87_RS14365 (D3Z87_14265) | - | 2697943..2698083 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| D3Z87_RS14370 (D3Z87_14270) | yqaF | 2698113..2698343 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| D3Z87_RS14375 (D3Z87_14275) | sknR | 2698520..2698870 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=314909 D3Z87_RS14045 WP_009967785.1 2652014..2652424(-) (nucA/comI) [Bacillus subtilis strain WB800N]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=314909 D3Z87_RS14045 WP_009967785.1 2652014..2652424(-) (nucA/comI) [Bacillus subtilis strain WB800N]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |