Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LL223_RS11630 | Genome accession | NZ_CP031926 |
| Coordinates | 2259687..2259971 (-) | Length | 94 a.a. |
| NCBI ID | WP_010906314.1 | Uniprot ID | A0AAC9R304 |
| Organism | Lactococcus lactis subsp. lactis strain 223 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2249457..2325982 | 2259687..2259971 | within | 0 |
Gene organization within MGE regions
Location: 2249457..2325982
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL223_RS11580 (LL223_2216) | - | 2249462..2251288 (-) | 1827 | WP_205288535.1 | acyltransferase family protein | - |
| LL223_RS11585 (LL223_2217) | - | 2251390..2253621 (-) | 2232 | WP_003129980.1 | PBP1A family penicillin-binding protein | - |
| LL223_RS11590 (LL223_2218) | - | 2253930..2254565 (-) | 636 | WP_010906307.1 | DUF421 domain-containing protein | - |
| LL223_RS11595 (LL223_2219) | - | 2254582..2255013 (-) | 432 | WP_010906308.1 | DUF3290 domain-containing protein | - |
| LL223_RS11600 (LL223_2220) | - | 2255127..2255504 (-) | 378 | WP_003129983.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LL223_RS11605 (LL223_2221) | - | 2255709..2256575 (+) | 867 | WP_010906309.1 | RluA family pseudouridine synthase | - |
| LL223_RS11610 (LL223_2222) | - | 2256614..2257423 (-) | 810 | WP_010906310.1 | metal ABC transporter permease | - |
| LL223_RS11615 (LL223_2223) | - | 2257416..2258153 (-) | 738 | WP_010906311.1 | metal ABC transporter ATP-binding protein | - |
| LL223_RS11620 (LL223_2224) | - | 2258330..2259172 (-) | 843 | WP_010906312.1 | metal ABC transporter substrate-binding protein | - |
| LL223_RS11625 (LL223_2225) | - | 2259169..2259606 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| LL223_RS11630 (LL223_2226) | comGG | 2259687..2259971 (-) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LL223_RS11635 (LL223_2227) | comGF | 2260010..2260456 (-) | 447 | WP_031296844.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LL223_RS11640 (LL223_2228) | comGE | 2260419..2260715 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LL223_RS11645 (LL223_2229) | comGD | 2260687..2261085 (-) | 399 | WP_021214886.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LL223_RS11650 (LL223_2230) | comGC | 2261078..2261347 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LL223_RS11655 (LL223_2231) | - | 2261494..2262018 (-) | 525 | WP_014570795.1 | GNAT family N-acetyltransferase | - |
| LL223_RS11660 (LL223_2232) | - | 2262097..2262876 (-) | 780 | WP_058147788.1 | peptidoglycan amidohydrolase family protein | - |
| LL223_RS11665 (LL223_2233) | - | 2262876..2263175 (-) | 300 | WP_031559226.1 | phage holin | - |
| LL223_RS11670 (LL223_2234) | - | 2263188..2263538 (-) | 351 | WP_023349296.1 | hypothetical protein | - |
| LL223_RS11675 (LL223_2235) | - | 2263558..2265612 (-) | 2055 | WP_373270652.1 | collagen-like protein | - |
| LL223_RS11680 (LL223_2236) | - | 2265596..2265769 (-) | 174 | WP_086383510.1 | hypothetical protein | - |
| LL223_RS11685 (LL223_2237) | - | 2265769..2266890 (-) | 1122 | WP_086383554.1 | hypothetical protein | - |
| LL223_RS11690 (LL223_2238) | - | 2266907..2268700 (-) | 1794 | WP_031297170.1 | phage tail protein | - |
| LL223_RS11695 (LL223_2239) | - | 2268697..2270217 (-) | 1521 | WP_058147722.1 | distal tail protein Dit | - |
| LL223_RS11700 (LL223_2240) | - | 2270227..2272836 (-) | 2610 | WP_023349195.1 | hypothetical protein | - |
| LL223_RS11705 (LL223_2241) | - | 2272826..2273533 (-) | 708 | WP_014570560.1 | Gp15 family bacteriophage protein | - |
| LL223_RS11710 (LL223_2242) | - | 2273549..2273956 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| LL223_RS11715 (LL223_2243) | - | 2274013..2274489 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| LL223_RS11720 (LL223_2244) | - | 2274500..2274934 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LL223_RS11725 (LL223_2245) | - | 2274934..2275263 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LL223_RS11730 (LL223_2246) | - | 2275260..2275604 (-) | 345 | WP_003131319.1 | putative minor capsid protein | - |
| LL223_RS11735 (LL223_2247) | - | 2275594..2275995 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LL223_RS11740 (LL223_2248) | - | 2276069..2276305 (-) | 237 | WP_023349196.1 | Ig-like domain-containing protein | - |
| LL223_RS11745 (LL223_2249) | - | 2276334..2277251 (-) | 918 | WP_023349197.1 | phage capsid protein | - |
| LL223_RS11750 (LL223_2250) | - | 2277266..2278318 (-) | 1053 | WP_023349198.1 | XkdF-like putative serine protease domain-containing protein | - |
| LL223_RS11755 (LL223_2251) | - | 2278334..2279164 (-) | 831 | WP_023349199.1 | phage minor head protein | - |
| LL223_RS11760 (LL223_2252) | - | 2279157..2280686 (-) | 1530 | WP_023349200.1 | phage portal protein | - |
| LL223_RS11765 (LL223_2253) | terL | 2280699..2282150 (-) | 1452 | WP_023349201.1 | phage terminase large subunit | - |
| LL223_RS11770 (LL223_2254) | - | 2282131..2282628 (-) | 498 | WP_023349202.1 | hypothetical protein | - |
| LL223_RS11775 (LL223_2255) | - | 2282657..2283814 (-) | 1158 | WP_023349203.1 | DNA modification methylase | - |
| LL223_RS11785 (LL223_2256) | - | 2284291..2284713 (-) | 423 | WP_023349204.1 | RinA family protein | - |
| LL223_RS11790 (LL223_2257) | - | 2285061..2285306 (-) | 246 | WP_023349207.1 | hypothetical protein | - |
| LL223_RS11795 (LL223_2258) | - | 2285328..2285825 (-) | 498 | WP_086383531.1 | hypothetical protein | - |
| LL223_RS11800 (LL223_2259) | - | 2285828..2286247 (-) | 420 | WP_086383533.1 | dUTP diphosphatase | - |
| LL223_RS11805 (LL223_2260) | - | 2286244..2286549 (-) | 306 | WP_023349170.1 | hypothetical protein | - |
| LL223_RS11810 (LL223_2261) | - | 2286546..2287049 (-) | 504 | WP_023349171.1 | DUF1642 domain-containing protein | - |
| LL223_RS11815 (LL223_2262) | - | 2287042..2287437 (-) | 396 | WP_058147723.1 | YopX family protein | - |
| LL223_RS11820 (LL223_2263) | - | 2287629..2287835 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| LL223_RS11825 (LL223_2264) | - | 2287943..2288353 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| LL223_RS11830 (LL223_2265) | - | 2288366..2288608 (-) | 243 | WP_023349173.1 | L-rhamnose isomerase | - |
| LL223_RS11835 (LL223_2266) | - | 2288601..2289524 (-) | 924 | WP_023349174.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LL223_RS11840 (LL223_2267) | - | 2289788..2290714 (-) | 927 | WP_014570813.1 | RecT family recombinase | - |
| LL223_RS11845 (LL223_2268) | - | 2290711..2291544 (-) | 834 | WP_023349175.1 | hypothetical protein | - |
| LL223_RS11850 (LL223_2269) | - | 2291647..2291895 (-) | 249 | WP_014570815.1 | hypothetical protein | - |
| LL223_RS11855 (LL223_03265) | - | 2291909..2292031 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LL223_RS11860 (LL223_2270) | - | 2292028..2292210 (-) | 183 | WP_023349176.1 | hypothetical protein | - |
| LL223_RS11865 (LL223_2271) | - | 2292274..2292483 (-) | 210 | WP_023349177.1 | helix-turn-helix transcriptional regulator | - |
| LL223_RS11870 (LL223_2272) | - | 2292674..2293096 (+) | 423 | WP_023349178.1 | helix-turn-helix transcriptional regulator | - |
| LL223_RS11875 (LL223_2273) | - | 2293107..2293691 (+) | 585 | WP_101916262.1 | hypothetical protein | - |
| LL223_RS11880 (LL223_2274) | - | 2293745..2294407 (+) | 663 | WP_023349180.1 | SHOCT domain-containing protein | - |
| LL223_RS11885 (LL223_2275) | - | 2294522..2295979 (+) | 1458 | WP_058147724.1 | recombinase family protein | - |
| LL223_RS11890 (LL223_03270) | - | 2295976..2296116 (-) | 141 | WP_228777719.1 | hypothetical protein | - |
| LL223_RS11895 (LL223_2276) | comGB | 2296130..2297203 (-) | 1074 | WP_010906319.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LL223_RS11900 (LL223_2277) | comGA | 2297097..2298035 (-) | 939 | WP_010906320.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LL223_RS11905 (LL223_2278) | - | 2298155..2303071 (-) | 4917 | WP_205288536.1 | PolC-type DNA polymerase III | - |
| LL223_RS11910 (LL223_2279) | - | 2303244..2303780 (-) | 537 | WP_010906322.1 | hypothetical protein | - |
| LL223_RS11915 (LL223_2280) | - | 2303786..2305117 (-) | 1332 | WP_010906323.1 | FAD/NAD(P)-binding oxidoreductase | - |
| LL223_RS11920 (LL223_2281) | - | 2305133..2306983 (-) | 1851 | WP_010906324.1 | proline--tRNA ligase | - |
| LL223_RS11925 (LL223_2282) | eeP | 2307053..2308339 (-) | 1287 | WP_010906325.1 | RIP metalloprotease RseP | Regulator |
| LL223_RS11930 (LL223_2283) | - | 2308358..2309161 (-) | 804 | WP_003130590.1 | phosphatidate cytidylyltransferase | - |
| LL223_RS11935 (LL223_2284) | - | 2309161..2309895 (-) | 735 | WP_010906326.1 | isoprenyl transferase | - |
| LL223_RS11940 (LL223_2285) | yajC | 2310267..2310599 (-) | 333 | WP_003130588.1 | preprotein translocase subunit YajC | - |
| LL223_RS11945 (LL223_2286) | - | 2310694..2311391 (-) | 698 | Protein_2328 | DNA alkylation repair protein | - |
| LL223_RS11950 (LL223_2287) | rlmH | 2311410..2311889 (-) | 480 | WP_003130585.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| LL223_RS11955 (LL223_2288) | - | 2311928..2312875 (-) | 948 | WP_003130410.1 | IS30 family transposase | - |
| LL223_RS11960 (LL223_2289) | htrA | 2313345..2314571 (+) | 1227 | WP_010906329.1 | S1C family serine protease | Regulator |
| LL223_RS11965 (LL223_2290) | - | 2314697..2315695 (+) | 999 | WP_010906330.1 | glycosyltransferase family 4 protein | - |
| LL223_RS11970 (LL223_2291) | - | 2315821..2317161 (+) | 1341 | WP_010906331.1 | glycosyltransferase family 4 protein | - |
| LL223_RS11975 (LL223_2292) | - | 2317269..2317493 (+) | 225 | WP_003130579.1 | YkuJ family protein | - |
| LL223_RS11980 (LL223_2293) | - | 2317635..2318639 (+) | 1005 | WP_010906332.1 | hypothetical protein | - |
| LL223_RS11985 (LL223_2294) | - | 2318680..2319432 (-) | 753 | WP_010906333.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| LL223_RS11990 (LL223_2295) | polA | 2319779..2322412 (-) | 2634 | WP_010906334.1 | DNA polymerase I | - |
| LL223_RS11995 (LL223_2296) | - | 2322650..2323459 (+) | 810 | WP_010906335.1 | Cof-type HAD-IIB family hydrolase | - |
| LL223_RS12000 (LL223_2297) | - | 2323459..2323866 (+) | 408 | Protein_2339 | LacI family DNA-binding transcriptional regulator | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10783.02 Da Isoelectric Point: 5.0604
>NTDB_id=312773 LL223_RS11630 WP_010906314.1 2259687..2259971(-) (comGG) [Lactococcus lactis subsp. lactis strain 223]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
Nucleotide
Download Length: 285 bp
>NTDB_id=312773 LL223_RS11630 WP_010906314.1 2259687..2259971(-) (comGG) [Lactococcus lactis subsp. lactis strain 223]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
59.14 |
98.936 |
0.585 |