Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   CAM50_RS18360 Genome accession   NZ_CP031913
Coordinates   3467094..3467723 (-) Length   209 a.a.
NCBI ID   WP_000839159.1    Uniprot ID   A0AAV3HCB2
Organism   Escherichia coli O157:H7 strain FWSEC0004     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3456016..3478897 3467094..3467723 within 0


Gene organization within MGE regions


Location: 3456016..3478897
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CAM50_RS18300 (CAM50_0019065) - 3456016..3457035 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  CAM50_RS18305 (CAM50_0019070) yccA 3457443..3458102 (+) 660 WP_000375128.1 FtsH protease modulator YccA -
  CAM50_RS18310 (CAM50_0019075) tusE 3458193..3458522 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  CAM50_RS18315 (CAM50_0019080) yccX 3458519..3458797 (-) 279 WP_000048252.1 acylphosphatase -
  CAM50_RS18320 (CAM50_0019085) rlmI 3458892..3460082 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  CAM50_RS18325 (CAM50_0019090) hspQ 3460140..3460457 (+) 318 WP_001295356.1 heat shock protein HspQ -
  CAM50_RS18330 (CAM50_0019095) yccU 3460502..3460915 (-) 414 WP_000665217.1 CoA-binding protein -
  CAM50_RS18335 (CAM50_0019100) yccT 3461088..3461750 (+) 663 WP_000847791.1 DUF2057 family protein -
  CAM50_RS18340 (CAM50_0019105) mgsA 3461846..3462304 (+) 459 WP_000424181.1 methylglyoxal synthase -
  CAM50_RS18345 (CAM50_0019110) helD 3462336..3464390 (-) 2055 WP_001301436.1 DNA helicase IV -
  CAM50_RS18350 (CAM50_0019115) yccF 3464513..3464959 (+) 447 WP_001261230.1 YccF domain-containing protein -
  CAM50_RS18355 (CAM50_0019120) yccS 3464969..3467131 (+) 2163 WP_000875023.1 YccS family putative transporter -
  CAM50_RS18360 (CAM50_0019125) sxy/tfoX 3467094..3467723 (-) 630 WP_000839159.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  CAM50_RS18365 (CAM50_0019130) sulA 3467942..3468451 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  CAM50_RS18370 (CAM50_0019140) ompA 3468808..3469848 (+) 1041 WP_000750416.1 porin OmpA -
  CAM50_RS18375 (CAM50_0019145) matP 3469924..3470376 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  CAM50_RS18380 (CAM50_0019150) ycbZ 3470562..3472322 (+) 1761 WP_000156526.1 Lon protease family protein -
  CAM50_RS18385 (CAM50_0019155) fabA 3472391..3472909 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  CAM50_RS18390 (CAM50_0019160) rmf 3472979..3473146 (-) 168 WP_000828648.1 ribosome modulation factor -
  CAM50_RS18395 (CAM50_0019165) pqiC 3473402..3473965 (-) 564 WP_000759107.1 membrane integrity-associated transporter subunit PqiC -
  CAM50_RS18400 (CAM50_0019170) pqiB 3473962..3475602 (-) 1641 WP_000445550.1 intermembrane transport protein PqiB -
  CAM50_RS18405 (CAM50_0019175) pqiA 3475607..3476860 (-) 1254 WP_000333170.1 membrane integrity-associated transporter subunit PqiA -
  CAM50_RS18410 (CAM50_0019180) uup 3476990..3478897 (-) 1908 WP_000053083.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24173.05 Da        Isoelectric Point: 9.1942

>NTDB_id=312662 CAM50_RS18360 WP_000839159.1 3467094..3467723(-) (sxy/tfoX) [Escherichia coli O157:H7 strain FWSEC0004]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKYPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=312662 CAM50_RS18360 WP_000839159.1 3467094..3467723(-) (sxy/tfoX) [Escherichia coli O157:H7 strain FWSEC0004]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAATATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment