Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   CCU03_RS20275 Genome accession   NZ_CP031912
Coordinates   3970691..3971275 (-) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli O111:NM strain FWSEC0005     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3948800..3987530 3970691..3971275 within 0


Gene organization within MGE regions


Location: 3948800..3987530
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CCU03_RS20110 (CCU03_021125) - 3948862..3949125 (-) 264 WP_000224233.1 hypothetical protein -
  CCU03_RS20115 (CCU03_021130) - 3949127..3949344 (-) 218 Protein_3911 DUF4014 family protein -
  CCU03_RS20120 (CCU03_021135) - 3949377..3949589 (-) 213 WP_000935420.1 hypothetical protein -
  CCU03_RS20125 (CCU03_021140) - 3949640..3949996 (-) 357 WP_000403777.1 hypothetical protein -
  CCU03_RS20130 (CCU03_021145) - 3949974..3950435 (-) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  CCU03_RS20135 (CCU03_021150) - 3950432..3950728 (-) 297 WP_001266135.1 DUF4406 domain-containing protein -
  CCU03_RS20140 (CCU03_021155) - 3950725..3951147 (-) 423 WP_001151153.1 DUF977 family protein -
  CCU03_RS20145 (CCU03_021160) - 3951188..3952258 (-) 1071 WP_001262389.1 hypothetical protein -
  CCU03_RS20150 (CCU03_021165) - 3952330..3952755 (-) 426 WP_000693949.1 toxin YdaT family protein -
  CCU03_RS20155 (CCU03_021170) - 3952752..3952967 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  CCU03_RS20160 (CCU03_021175) - 3953017..3953733 (+) 717 WP_000103686.1 S24 family peptidase -
  CCU03_RS20170 (CCU03_021185) ydfA 3954006..3954158 (+) 153 WP_000379580.1 DUF1391 family protein -
  CCU03_RS20175 (CCU03_021190) - 3954170..3954544 (+) 375 WP_000394557.1 hypothetical protein -
  CCU03_RS20180 (CCU03_021200) dicB 3955076..3955264 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  CCU03_RS20185 (CCU03_021205) - 3955261..3955452 (+) 192 WP_001090200.1 DUF1482 family protein -
  CCU03_RS20190 (CCU03_021210) - 3955545..3956966 (+) 1422 Protein_3925 exonuclease -
  CCU03_RS20195 (CCU03_021215) - 3957021..3958234 (+) 1214 WP_162829202.1 IS3-like element IS1203 family transposase -
  CCU03_RS20205 (CCU03_021220) - 3958277..3959329 (+) 1053 Protein_3927 3'-5' exoribonuclease -
  CCU03_RS20210 - 3959397..3959639 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  CCU03_RS20215 (CCU03_021225) - 3959617..3960632 (+) 1016 Protein_3929 tyrosine-type recombinase/integrase -
  CCU03_RS20220 (CCU03_021230) yccA 3961040..3961699 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  CCU03_RS20225 (CCU03_021235) tusE 3961790..3962119 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  CCU03_RS20230 (CCU03_021240) yccX 3962116..3962394 (-) 279 WP_000048244.1 acylphosphatase -
  CCU03_RS20235 (CCU03_021245) rlmI 3962489..3963679 (+) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  CCU03_RS20240 (CCU03_021250) hspQ 3963737..3964054 (+) 318 WP_001295356.1 heat shock protein HspQ -
  CCU03_RS20245 (CCU03_021255) yccU 3964099..3964512 (-) 414 WP_000665217.1 CoA-binding protein -
  CCU03_RS20250 (CCU03_021260) yccT 3964685..3965347 (+) 663 WP_000847791.1 DUF2057 family protein -
  CCU03_RS20255 (CCU03_021265) mgsA 3965443..3965901 (+) 459 WP_000424181.1 methylglyoxal synthase -
  CCU03_RS20260 (CCU03_021270) helD 3965933..3967987 (-) 2055 WP_001297106.1 DNA helicase IV -
  CCU03_RS20265 (CCU03_021275) yccF 3968110..3968556 (+) 447 WP_001261235.1 YccF domain-containing protein -
  CCU03_RS20270 (CCU03_021280) yccS 3968566..3970728 (+) 2163 WP_000875023.1 YccS family putative transporter -
  CCU03_RS20275 (CCU03_021285) sxy/tfoX 3970691..3971275 (-) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  CCU03_RS20280 (CCU03_021290) sulA 3971539..3972048 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  CCU03_RS20285 (CCU03_021300) ompA 3972405..3973445 (+) 1041 WP_000750416.1 porin OmpA -
  CCU03_RS20290 (CCU03_021305) matP 3973521..3973973 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  CCU03_RS20295 (CCU03_021310) ycbZ 3974159..3975919 (+) 1761 WP_000156528.1 Lon protease family protein -
  CCU03_RS20300 (CCU03_021315) fabA 3975988..3976506 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  CCU03_RS20305 (CCU03_021320) rmf 3976576..3976743 (-) 168 WP_000828648.1 ribosome modulation factor -
  CCU03_RS20310 (CCU03_021325) pqiC 3976999..3977562 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  CCU03_RS20315 (CCU03_021330) pqiB 3977559..3979199 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  CCU03_RS20320 (CCU03_021335) pqiA 3979204..3980457 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  CCU03_RS20325 (CCU03_021340) uup 3980587..3982494 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  CCU03_RS20330 (CCU03_021345) rlmKL 3982506..3984614 (-) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  CCU03_RS20335 (CCU03_021350) ycbX 3984858..3985967 (+) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  CCU03_RS20340 (CCU03_021355) zapC 3985964..3986506 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=312640 CCU03_RS20275 WP_077825616.1 3970691..3971275(-) (sxy/tfoX) [Escherichia coli O111:NM strain FWSEC0005]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=312640 CCU03_RS20275 WP_077825616.1 3970691..3971275(-) (sxy/tfoX) [Escherichia coli O111:NM strain FWSEC0005]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment