Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   CAX06_RS15425 Genome accession   NZ_CP031906
Coordinates   3081845..3082474 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli O91:H21 strain FWSEC0008     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3070767..3093648 3081845..3082474 within 0


Gene organization within MGE regions


Location: 3070767..3093648
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CAX06_RS15365 (CAX06_016175) - 3070767..3071786 (+) 1020 WP_001367167.1 tyrosine-type recombinase/integrase -
  CAX06_RS15370 (CAX06_016180) yccA 3072194..3072853 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  CAX06_RS15375 (CAX06_016185) tusE 3072944..3073273 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  CAX06_RS15380 (CAX06_016190) yccX 3073270..3073548 (-) 279 WP_000048250.1 acylphosphatase -
  CAX06_RS15385 (CAX06_016195) rlmI 3073643..3074833 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  CAX06_RS15390 (CAX06_016200) hspQ 3074891..3075208 (+) 318 WP_001295356.1 heat shock protein HspQ -
  CAX06_RS15395 (CAX06_016205) yccU 3075253..3075666 (-) 414 WP_000665217.1 CoA-binding protein -
  CAX06_RS15400 (CAX06_016210) yccT 3075839..3076501 (+) 663 WP_000847791.1 DUF2057 family protein -
  CAX06_RS15405 (CAX06_016215) mgsA 3076597..3077055 (+) 459 WP_000424181.1 methylglyoxal synthase -
  CAX06_RS15410 (CAX06_016220) helD 3077087..3079141 (-) 2055 WP_000420533.1 DNA helicase IV -
  CAX06_RS15415 (CAX06_016225) yccF 3079264..3079710 (+) 447 WP_001261231.1 YccF domain-containing protein -
  CAX06_RS15420 (CAX06_016230) yccS 3079720..3081882 (+) 2163 WP_000875044.1 YccS family putative transporter -
  CAX06_RS15425 (CAX06_016235) sxy/tfoX 3081845..3082474 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  CAX06_RS15430 (CAX06_016240) sulA 3082693..3083202 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  CAX06_RS15435 (CAX06_016250) ompA 3083559..3084599 (+) 1041 WP_000750416.1 porin OmpA -
  CAX06_RS15440 (CAX06_016255) matP 3084675..3085127 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  CAX06_RS15445 (CAX06_016260) ycbZ 3085313..3087073 (+) 1761 WP_000156526.1 Lon protease family protein -
  CAX06_RS15450 (CAX06_016265) fabA 3087142..3087660 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  CAX06_RS15455 (CAX06_016270) rmf 3087730..3087897 (-) 168 WP_000828648.1 ribosome modulation factor -
  CAX06_RS15460 (CAX06_016275) pqiC 3088153..3088716 (-) 564 WP_000759129.1 membrane integrity-associated transporter subunit PqiC -
  CAX06_RS15465 (CAX06_016280) pqiB 3088713..3090353 (-) 1641 WP_000445534.1 intermembrane transport protein PqiB -
  CAX06_RS15470 (CAX06_016285) pqiA 3090358..3091611 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  CAX06_RS15475 (CAX06_016290) uup 3091741..3093648 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=312574 CAX06_RS15425 WP_000839153.1 3081845..3082474(-) (sxy/tfoX) [Escherichia coli O91:H21 strain FWSEC0008]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=312574 CAX06_RS15425 WP_000839153.1 3081845..3082474(-) (sxy/tfoX) [Escherichia coli O91:H21 strain FWSEC0008]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment