Detailed information
Overview
| Name | amiF | Type | Regulator |
| Locus tag | D1O36_RS11230 | Genome accession | NZ_CP031881 |
| Coordinates | 1320683..1320853 (-) | Length | 56 a.a. |
| NCBI ID | WP_014608546.1 | Uniprot ID | A0A2U2MH52 |
| Organism | Streptococcus thermophilus strain ST106 | ||
| Function | internalize XIP (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1294679..1364531 | 1320683..1320853 | within | 0 |
| IScluster/Tn | 1317027..1324391 | 1320683..1320853 | within | 0 |
Gene organization within MGE regions
Location: 1294679..1364531
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1O36_RS07010 (D1O36_07040) | liaF | 1294687..1295384 (-) | 698 | Protein_1307 | cell wall-active antibiotics response protein LiaF | - |
| D1O36_RS10815 | - | 1295650..1295805 (-) | 156 | WP_011226290.1 | ion channel | - |
| D1O36_RS07020 (D1O36_07050) | stkP/pknB | 1296442..1298313 (-) | 1872 | WP_024009998.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | Regulator |
| D1O36_RS07025 (D1O36_07055) | - | 1298313..1299050 (-) | 738 | WP_134973348.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| D1O36_RS07030 (D1O36_07060) | rsmB | 1299094..1300415 (-) | 1322 | Protein_1311 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| D1O36_RS07035 (D1O36_07065) | fmt | 1300405..1301340 (-) | 936 | WP_002951411.1 | methionyl-tRNA formyltransferase | - |
| D1O36_RS07040 (D1O36_07070) | - | 1301358..1303754 (-) | 2397 | WP_134973349.1 | primosomal protein N' | - |
| D1O36_RS07045 (D1O36_07075) | rpoZ | 1303896..1304210 (-) | 315 | WP_041829315.1 | DNA-directed RNA polymerase subunit omega | - |
| D1O36_RS07050 (D1O36_07080) | gmk | 1304232..1304861 (-) | 630 | WP_002951416.1 | guanylate kinase | - |
| D1O36_RS07055 (D1O36_07085) | ftsY | 1305087..1306478 (-) | 1392 | WP_134973350.1 | signal recognition particle-docking protein FtsY | - |
| D1O36_RS07060 (D1O36_07090) | - | 1306492..1307307 (-) | 816 | WP_002951420.1 | Cof-type HAD-IIB family hydrolase | - |
| D1O36_RS07065 (D1O36_07095) | - | 1307300..1308094 (-) | 795 | WP_024010002.1 | HAD family hydrolase | - |
| D1O36_RS07070 (D1O36_07100) | - | 1308279..1308656 (+) | 378 | WP_024010003.1 | GntR family transcriptional regulator | - |
| D1O36_RS07075 (D1O36_07105) | - | 1308661..1309359 (+) | 699 | WP_134973351.1 | ABC transporter ATP-binding protein | - |
| D1O36_RS07080 (D1O36_07110) | - | 1309371..1310156 (+) | 786 | WP_002951425.1 | hypothetical protein | - |
| D1O36_RS07085 (D1O36_07115) | amiF | 1310206..1311135 (-) | 930 | WP_011681415.1 | ATP-binding cassette domain-containing protein | Regulator |
| D1O36_RS07090 (D1O36_07120) | amiE | 1311128..1312213 (-) | 1086 | WP_011226304.1 | ABC transporter ATP-binding protein | Regulator |
| D1O36_RS07095 (D1O36_07125) | amiD | 1312223..1313149 (-) | 927 | WP_134973352.1 | oligopeptide ABC transporter permease OppC | Regulator |
| D1O36_RS07100 (D1O36_07130) | amiC | 1313149..1314642 (-) | 1494 | WP_065972442.1 | ABC transporter permease | Regulator |
| D1O36_RS07105 (D1O36_07135) | amiA | 1314704..1316671 (-) | 1968 | WP_134973353.1 | peptide ABC transporter substrate-binding protein | Regulator |
| D1O36_RS07110 (D1O36_07140) | - | 1317027..1318278 (+) | 1252 | Protein_1327 | ISL3 family transposase | - |
| D1O36_RS07115 (D1O36_07145) | amiA3 | 1318323..1320296 (-) | 1974 | WP_134973354.1 | peptide ABC transporter substrate-binding protein | Regulator |
| D1O36_RS07120 (D1O36_07150) | - | 1320502..1320692 (-) | 191 | Protein_1329 | IS3 family transposase | - |
| D1O36_RS11230 (D1O36_07155) | amiF | 1320683..1320853 (-) | 171 | WP_014608546.1 | hypothetical protein | Regulator |
| D1O36_RS11235 | - | 1320869..1321441 (-) | 573 | Protein_1331 | TatD family hydrolase | - |
| D1O36_RS07140 (D1O36_07170) | - | 1321786..1322991 (+) | 1206 | WP_011227415.1 | OFA family MFS transporter | - |
| D1O36_RS10385 (D1O36_07175) | - | 1323038..1324391 (-) | 1354 | Protein_1333 | IS3 family transposase | - |
| D1O36_RS07150 (D1O36_07180) | pta | 1324477..1325460 (-) | 984 | WP_134973355.1 | phosphate acetyltransferase | - |
| D1O36_RS07155 (D1O36_07185) | - | 1325474..1326370 (-) | 897 | WP_011226316.1 | RluA family pseudouridine synthase | - |
| D1O36_RS07160 (D1O36_07190) | - | 1326367..1327203 (-) | 837 | WP_065972449.1 | NAD kinase | - |
| D1O36_RS07165 (D1O36_07195) | - | 1327175..1327849 (-) | 675 | WP_011681427.1 | GTP pyrophosphokinase family protein | - |
| D1O36_RS07170 (D1O36_07200) | - | 1327945..1328520 (+) | 576 | WP_002951444.1 | CYTH domain-containing protein | - |
| D1O36_RS07175 (D1O36_07205) | - | 1328885..1329856 (+) | 972 | WP_002951446.1 | ribose-phosphate diphosphokinase | - |
| D1O36_RS07180 (D1O36_07210) | - | 1329860..1330971 (+) | 1112 | Protein_1340 | cysteine desulfurase family protein | - |
| D1O36_RS07185 (D1O36_07215) | - | 1330973..1331320 (+) | 348 | WP_002948028.1 | DUF1831 domain-containing protein | - |
| D1O36_RS07190 (D1O36_07220) | - | 1331464..1332123 (+) | 660 | WP_071417293.1 | redox-sensing transcriptional repressor Rex | - |
| D1O36_RS07195 (D1O36_07225) | - | 1332116..1332811 (+) | 696 | WP_002951449.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| D1O36_RS07200 (D1O36_07230) | radC | 1332864..1333550 (-) | 687 | WP_011226324.1 | DNA repair protein RadC | - |
| D1O36_RS07205 (D1O36_07235) | - | 1333599..1335383 (-) | 1785 | WP_134973356.1 | rhamnan synthesis F family protein | - |
| D1O36_RS07210 (D1O36_07240) | - | 1335380..1336435 (-) | 1056 | WP_002948022.1 | glycosyltransferase | - |
| D1O36_RS07215 (D1O36_07245) | - | 1336455..1337660 (-) | 1206 | WP_113870315.1 | ABC transporter ATP-binding protein | - |
| D1O36_RS07220 (D1O36_07250) | - | 1337660..1338469 (-) | 810 | WP_002948020.1 | ABC transporter permease | - |
| D1O36_RS07225 (D1O36_07255) | - | 1338453..1339409 (-) | 957 | WP_011226328.1 | glycosyltransferase family 2 protein | - |
| D1O36_RS07230 (D1O36_07260) | - | 1339406..1340554 (-) | 1149 | WP_041828290.1 | glycosyltransferase family 1 protein | - |
| D1O36_RS07235 (D1O36_07265) | - | 1340661..1342202 (-) | 1542 | WP_134973357.1 | DUF2142 domain-containing protein | - |
| D1O36_RS07240 (D1O36_07270) | - | 1342209..1343213 (-) | 1005 | WP_100284794.1 | glycosyltransferase family A protein | - |
| D1O36_RS07245 (D1O36_07275) | - | 1343213..1344487 (-) | 1275 | WP_134973359.1 | lipopolysaccharide biosynthesis protein | - |
| D1O36_RS07250 (D1O36_07280) | - | 1344480..1344812 (-) | 333 | WP_011226332.1 | DUF2304 domain-containing protein | - |
| D1O36_RS07255 (D1O36_07285) | - | 1344818..1345513 (-) | 696 | WP_173405413.1 | glycosyltransferase family 2 protein | - |
| D1O36_RS07260 (D1O36_07290) | rfbD | 1345588..1346439 (-) | 852 | WP_002951456.1 | dTDP-4-dehydrorhamnose reductase | - |
| D1O36_RS07265 (D1O36_07295) | - | 1346524..1347997 (-) | 1474 | Protein_1357 | glucosyltransferase domain-containing protein | - |
| D1O36_RS07270 (D1O36_07300) | - | 1348002..1348928 (-) | 927 | WP_134973361.1 | glycosyltransferase family 2 protein | - |
| D1O36_RS07275 (D1O36_07305) | - | 1348939..1349274 (-) | 336 | WP_002891474.1 | metal-sulfur cluster assembly factor | - |
| D1O36_RS07280 (D1O36_07310) | rpoD | 1349328..1350437 (-) | 1110 | WP_011227440.1 | RNA polymerase sigma factor RpoD | - |
| D1O36_RS07285 (D1O36_07315) | dnaG | 1350441..1352252 (-) | 1812 | WP_011681448.1 | DNA primase | - |
| D1O36_RS07290 (D1O36_07320) | mscL | 1352392..1352475 (+) | 84 | Protein_1362 | large conductance mechanosensitive channel protein MscL | - |
| D1O36_RS07295 (D1O36_07325) | rpsU | 1352635..1352811 (-) | 177 | WP_011681449.1 | 30S ribosomal protein S21 | - |
| D1O36_RS07300 (D1O36_07330) | - | 1353006..1353800 (-) | 795 | WP_023909836.1 | ABC transporter substrate-binding protein | - |
| D1O36_RS07305 (D1O36_07335) | - | 1353862..1354971 (-) | 1110 | WP_024703959.1 | aminotransferase | - |
| D1O36_RS07310 (D1O36_07340) | - | 1355318..1356115 (-) | 798 | WP_134973363.1 | transporter substrate-binding domain-containing protein | - |
| D1O36_RS07315 (D1O36_07345) | - | 1356112..1356942 (-) | 831 | WP_134973364.1 | transporter substrate-binding domain-containing protein | - |
| D1O36_RS07320 (D1O36_07350) | - | 1357155..1357619 (-) | 465 | WP_134973366.1 | 8-oxo-dGTP diphosphatase | - |
| D1O36_RS07325 (D1O36_07355) | uvrB | 1357664..1359655 (-) | 1992 | WP_002953358.1 | excinuclease ABC subunit UvrB | - |
| D1O36_RS11240 (D1O36_07365) | - | 1360347..1361284 (-) | 938 | Protein_1370 | type II CAAX endopeptidase family protein | - |
| D1O36_RS07340 (D1O36_07370) | - | 1361483..1363693 (+) | 2211 | WP_134973368.1 | ABC transporter substrate-binding protein/permease | - |
| D1O36_RS07345 (D1O36_07375) | - | 1363693..1364433 (+) | 741 | WP_002945131.1 | amino acid ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 56 a.a. Molecular weight: 6495.42 Da Isoelectric Point: 4.6436
>NTDB_id=312365 D1O36_RS11230 WP_014608546.1 1320683..1320853(-) (amiF) [Streptococcus thermophilus strain ST106]
MEVAETEELYNNPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMV
MEVAETEELYNNPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMV
Nucleotide
Download Length: 171 bp
>NTDB_id=312365 D1O36_RS11230 WP_014608546.1 1320683..1320853(-) (amiF) [Streptococcus thermophilus strain ST106]
GTGGAAGTTGCTGAGACAGAAGAGCTCTACAACAATCCTATCCATCCTTATACCAAGTCACTCTTGTCTGCTGTTCCTAT
TCCAGATCCAATCTTGGAACGTAAGAAAGTCTTGAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAG
AAATGGTATGA
GTGGAAGTTGCTGAGACAGAAGAGCTCTACAACAATCCTATCCATCCTTATACCAAGTCACTCTTGTCTGCTGTTCCTAT
TCCAGATCCAATCTTGGAACGTAAGAAAGTCTTGAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAG
AAATGGTATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| amiF | Streptococcus thermophilus LMG 18311 |
98.214 |
100 |
0.982 |
| amiF | Streptococcus thermophilus LMD-9 |
98.214 |
100 |
0.982 |
| amiF | Streptococcus salivarius strain HSISS4 |
98.214 |
100 |
0.982 |