Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   D0808_RS08720 Genome accession   NZ_CP031783
Coordinates   1695832..1696023 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis strain MENO2 voucher National Research Centre     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1690832..1701023
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D0808_RS08690 (D0808_08785) argF 1691694..1692653 (+) 960 WP_153255900.1 ornithine carbamoyltransferase -
  D0808_RS08695 (D0808_08790) yjzC 1692739..1692918 (+) 180 WP_003245356.1 YjzC family protein -
  D0808_RS08700 (D0808_08795) yjzD 1692965..1693150 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  D0808_RS08705 (D0808_08800) - 1693400..1694134 (+) 735 WP_049140719.1 hypothetical protein -
  D0808_RS08710 (D0808_08805) - 1694216..1694773 (+) 558 WP_014476424.1 hypothetical protein -
  D0808_RS08715 (D0808_08810) med 1694864..1695817 (+) 954 WP_014476425.1 transcriptional regulator Med Regulator
  D0808_RS08720 (D0808_08815) comZ 1695832..1696023 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  D0808_RS08725 (D0808_08820) yjzB 1696053..1696289 (-) 237 WP_015383342.1 spore coat protein YjzB -
  D0808_RS08730 (D0808_08825) fabH 1696454..1697392 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  D0808_RS08735 (D0808_08830) fabF 1697415..1698656 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  D0808_RS08740 (D0808_08835) yjaZ 1698732..1699517 (+) 786 WP_134982187.1 DUF2268 domain-containing protein -
  D0808_RS08745 (D0808_08840) appD 1699709..1700695 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=311294 D0808_RS08720 WP_003224559.1 1695832..1696023(+) (comZ) [Bacillus subtilis strain MENO2 voucher National Research Centre]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=311294 D0808_RS08720 WP_003224559.1 1695832..1696023(+) (comZ) [Bacillus subtilis strain MENO2 voucher National Research Centre]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment