Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   DXY22_RS16035 Genome accession   NZ_CP031693
Coordinates   3141255..3141665 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain SRCM101393     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3134358..3171191 3141255..3141665 within 0


Gene organization within MGE regions


Location: 3134358..3171191
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXY22_RS15995 (DXY22_03147) yqeH 3134358..3135458 (-) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  DXY22_RS16000 (DXY22_03148) yqeG 3135462..3135980 (-) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  DXY22_RS16005 - 3136342..3136482 (+) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  DXY22_RS16010 (DXY22_03150) yqeF 3136788..3137519 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  DXY22_RS16015 (DXY22_03151) cwlH 3137771..3138523 (-) 753 WP_015251672.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  DXY22_RS16020 (DXY22_03152) yqeD 3138710..3139336 (+) 627 WP_015251671.1 TVP38/TMEM64 family protein -
  DXY22_RS16025 (DXY22_03153) gnd 3139355..3140248 (-) 894 WP_015251670.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  DXY22_RS16030 (DXY22_03154) yqeB 3140500..3141222 (+) 723 WP_010886572.1 hypothetical protein -
  DXY22_RS16035 (DXY22_03155) nucA/comI 3141255..3141665 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  DXY22_RS16040 (DXY22_03156) - 3141861..3142211 (+) 351 Protein_3132 sigma-70 family RNA polymerase sigma factor -
  DXY22_RS16045 (DXY22_03157) - 3142351..3142821 (+) 471 WP_015251668.1 MarR family transcriptional regulator -
  DXY22_RS16050 (DXY22_03158) - 3142971..3144383 (+) 1413 WP_015251667.1 MDR family MFS transporter -
  DXY22_RS16055 (DXY22_03159) spoIVCA 3144570..3146030 (-) 1461 WP_235701260.1 site-specific DNA recombinase SpoIVCA -
  DXY22_RS21205 - 3145988..3146166 (-) 179 Protein_3136 hypothetical protein -
  DXY22_RS16060 (DXY22_03160) - 3146810..3147907 (-) 1098 WP_032726210.1 glycosyl hydrolase -
  DXY22_RS21210 - 3148409..3148498 (-) 90 Protein_3138 hypothetical protein -
  DXY22_RS16065 (DXY22_03163) - 3148840..3149967 (-) 1128 WP_015251664.1 Rap family tetratricopeptide repeat protein -
  DXY22_RS21215 - 3150361..3150441 (+) 81 Protein_3140 RNA polymerase subunit sigma -
  DXY22_RS16070 (DXY22_03165) - 3150747..3151421 (+) 675 WP_015251663.1 TraX family protein -
  DXY22_RS16075 - 3151560..3151694 (+) 135 WP_015251662.1 hypothetical protein -
  DXY22_RS16080 (DXY22_03166) - 3151805..3151964 (+) 160 Protein_3143 hypothetical protein -
  DXY22_RS16085 (DXY22_03167) - 3152334..3154100 (+) 1767 WP_015251660.1 T7SS effector LXG polymorphic toxin -
  DXY22_RS16090 (DXY22_03168) - 3154114..3154578 (+) 465 WP_015251659.1 SMI1/KNR4 family protein -
  DXY22_RS16095 (DXY22_03169) - 3154781..3155503 (-) 723 WP_015251658.1 NPP1 family protein -
  DXY22_RS16100 (DXY22_03170) - 3156101..3156664 (-) 564 WP_015251657.1 TetR/AcrR family transcriptional regulator -
  DXY22_RS16105 (DXY22_03171) - 3156862..3157749 (+) 888 WP_015251656.1 NmrA family NAD(P)-binding protein -
  DXY22_RS16110 (DXY22_03172) - 3157799..3158767 (-) 969 WP_015251655.1 N-acetylmuramoyl-L-alanine amidase -
  DXY22_RS16115 - 3158812..3158952 (-) 141 Protein_3150 phage holin family protein -
  DXY22_RS16120 (DXY22_03173) - 3158979..3159164 (-) 186 Protein_3151 phage terminase large subunit -
  DXY22_RS16125 terS 3159161..3159931 (-) 771 Protein_3152 phage terminase small subunit -
  DXY22_RS16130 - 3160113..3160199 (+) 87 WP_073991391.1 YjcZ family sporulation protein -
  DXY22_RS16135 (DXY22_03176) - 3160240..3160332 (+) 93 WP_080019512.1 YjcZ family sporulation protein -
  DXY22_RS16140 (DXY22_03177) - 3160518..3160733 (-) 216 WP_080019511.1 CotD family spore coat protein -
  DXY22_RS16145 yqaQ 3161291..3161700 (-) 410 Protein_3156 sigma factor-like helix-turn-helix DNA-binding protein -
  DXY22_RS16150 (DXY22_03179) - 3161998..3162264 (+) 267 WP_029318115.1 hypothetical protein -
  DXY22_RS21220 - 3162356..3162539 (-) 184 Protein_3158 hypothetical protein -
  DXY22_RS16155 - 3162610..3162793 (-) 184 Protein_3159 XtrA/YqaO family protein -
  DXY22_RS16160 (DXY22_03180) - 3163265..3164107 (+) 843 WP_015251648.1 sialate O-acetylesterase -
  DXY22_RS16165 (DXY22_03181) - 3164104..3164646 (+) 543 WP_015251647.1 PadR family transcriptional regulator -
  DXY22_RS16170 (DXY22_03182) yqaC 3164842..3165378 (-) 537 WP_015251646.1 AAA family ATPase -
  DXY22_RS16175 (DXY22_03184) yqaB 3165647..3166165 (+) 519 WP_015251645.1 ImmA/IrrE family metallo-endopeptidase -
  DXY22_RS16180 (DXY22_03185) - 3166171..3166563 (+) 393 Protein_3164 sigma-70 family RNA polymerase sigma factor -
  DXY22_RS21225 - 3166563..3166628 (+) 66 Protein_3165 hypothetical protein -
  DXY22_RS16190 (DXY22_03186) yrkQ 3166657..3167955 (-) 1299 WP_003246194.1 two-component system sensor histidine kinase YrkQ -
  DXY22_RS16195 (DXY22_03187) yrkP 3167942..3168637 (-) 696 WP_003229895.1 two-component response regulator YrkP -
  DXY22_RS16200 (DXY22_03188) yrkO 3168905..3170122 (+) 1218 WP_003229894.1 DUF418 domain-containing protein -
  DXY22_RS16205 - 3170041..3170289 (+) 249 WP_119123070.1 hypothetical protein -
  DXY22_RS16210 (DXY22_03189) yrkN 3170634..3171191 (+) 558 WP_029318133.1 GNAT family N-acetyltransferase -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=310349 DXY22_RS16035 WP_009967785.1 3141255..3141665(-) (nucA/comI) [Bacillus subtilis strain SRCM101393]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=310349 DXY22_RS16035 WP_009967785.1 3141255..3141665(-) (nucA/comI) [Bacillus subtilis strain SRCM101393]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCTGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGCTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGAGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTACGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment