Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | ES300_RS02500 | Genome accession | NZ_CP038251 |
| Coordinates | 495081..495230 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain TVO_1901944 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 490081..500230
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ES300_RS02455 (ES300_02585) | blpI | 490993..491190 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| ES300_RS02460 (ES300_02595) | blpJ | 491656..491925 (+) | 270 | WP_001093249.1 | bacteriocin-like peptide BlpJ | - |
| ES300_RS02465 | - | 491994..492223 (+) | 230 | Protein_493 | Blp family class II bacteriocin | - |
| ES300_RS02470 (ES300_02605) | - | 492226..492345 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| ES300_RS02475 (ES300_02610) | - | 492642..492806 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| ES300_RS02480 (ES300_02615) | - | 492803..493207 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| ES300_RS02485 (ES300_02620) | - | 493410..494214 (+) | 805 | WP_128903587.1 | IS5 family transposase | - |
| ES300_RS02490 (ES300_02625) | blpM | 494364..494618 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| ES300_RS02495 (ES300_02630) | blpN | 494634..494837 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| ES300_RS02500 (ES300_02640) | cipB | 495081..495230 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| ES300_RS10850 | - | 495266..495331 (+) | 66 | Protein_501 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| ES300_RS02505 (ES300_02645) | - | 495334..495453 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ES300_RS02510 (ES300_02655) | - | 496316..497662 (+) | 1347 | WP_001809444.1 | IS1380-like element ISSpn5 family transposase | - |
| ES300_RS02515 (ES300_02660) | - | 497947..498330 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| ES300_RS02520 (ES300_02665) | - | 498382..499071 (+) | 690 | WP_000760529.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ES300_RS02525 (ES300_02670) | blpZ | 499113..499346 (+) | 234 | WP_001849865.1 | immunity protein BlpZ | - |
| ES300_RS02530 (ES300_02680) | - | 499497..500108 (+) | 612 | WP_000394037.1 | CPBP family intramembrane glutamic endopeptidase | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=310081 ES300_RS02500 WP_001818346.1 495081..495230(+) (cipB) [Streptococcus pneumoniae strain TVO_1901944]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=310081 ES300_RS02500 WP_001818346.1 495081..495230(+) (cipB) [Streptococcus pneumoniae strain TVO_1901944]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |