Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   E3C75_RS00050 Genome accession   NZ_CP038020
Coordinates   7536..7775 (-) Length   79 a.a.
NCBI ID   WP_021152514.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain ATCC 19258     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 2536..12775
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3C75_RS00020 - 4260..4640 (-) 381 WP_084829082.1 bacteriocin secretion protein -
  E3C75_RS00025 - 4765..5028 (-) 264 WP_002945924.1 hypothetical protein -
  E3C75_RS00030 - 5350..5646 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  E3C75_RS00035 - 5811..6737 (-) 927 WP_022096485.1 thioredoxin family protein -
  E3C75_RS00040 - 6924..7103 (-) 180 WP_011681564.1 hypothetical protein -
  E3C75_RS00045 - 7132..7524 (-) 393 WP_084829084.1 hypothetical protein -
  E3C75_RS00050 cipB 7536..7775 (-) 240 WP_021152514.1 Blp family class II bacteriocin Regulator
  E3C75_RS00055 - 8361..8615 (-) 255 WP_021152515.1 Blp family class II bacteriocin -
  E3C75_RS12060 - 8866..9267 (-) 402 WP_011226490.1 hypothetical protein -
  E3C75_RS11010 - 9597..9764 (-) 168 WP_011226492.1 hypothetical protein -
  E3C75_RS11015 - 10122..10283 (-) 162 WP_011681568.1 hypothetical protein -
  E3C75_RS00070 - 10290..10520 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  E3C75_RS00075 - 10876..11076 (-) 201 WP_011681569.1 hypothetical protein -
  E3C75_RS00080 - 11095..11271 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  E3C75_RS12065 - 11522..11923 (-) 402 WP_011226490.1 hypothetical protein -
  E3C75_RS11020 - 12253..12420 (-) 168 WP_011226492.1 hypothetical protein -

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7695.63 Da        Isoelectric Point: 3.8735

>NTDB_id=309168 E3C75_RS00050 WP_021152514.1 7536..7775(-) (cipB) [Streptococcus thermophilus strain ATCC 19258]
MATQTIENFNTLDLETLASVEGGRVNWERWGVCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=309168 E3C75_RS00050 WP_021152514.1 7536..7775(-) (cipB) [Streptococcus thermophilus strain ATCC 19258]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAGTGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405

Multiple sequence alignment