Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   EYC12_RS04690 Genome accession   NZ_CP036396
Coordinates   977725..977850 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain 12C8     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 972725..982850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EYC12_RS04670 - 973426..974829 (-) 1404 WP_000694860.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  EYC12_RS04675 comB10 974894..976030 (-) 1137 WP_001045899.1 DNA type IV secretion system protein ComB10 Machinery gene
  EYC12_RS04680 comB9 976023..976985 (-) 963 WP_001987609.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EYC12_RS04685 comB8 976985..977728 (-) 744 WP_000660543.1 virB8 family protein Machinery gene
  EYC12_RS04690 comB7 977725..977850 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  EYC12_RS04695 comB6 977866..978921 (-) 1056 WP_000786643.1 P-type conjugative transfer protein TrbL Machinery gene
  EYC12_RS04700 - 978927..979922 (-) 996 WP_000468812.1 PDZ domain-containing protein -
  EYC12_RS04705 - 979922..980215 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  EYC12_RS04710 panD 980226..980576 (-) 351 WP_000142212.1 aspartate 1-decarboxylase -
  EYC12_RS04715 - 980566..982788 (-) 2223 WP_001051530.1 AAA family ATPase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=307731 EYC12_RS04690 WP_001217874.1 977725..977850(-) (comB7) [Helicobacter pylori strain 12C8]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=307731 EYC12_RS04690 WP_001217874.1 977725..977850(-) (comB7) [Helicobacter pylori strain 12C8]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878