Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilJ   Type   Machinery gene
Locus tag   DV160_RS10100 Genome accession   NZ_CP031336
Coordinates   1692095..1693033 (-) Length   312 a.a.
NCBI ID   WP_002220674.1    Uniprot ID   -
Organism   Neisseria meningitidis strain M21717     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1647947..1706424 1692095..1693033 within 0


Gene organization within MGE regions


Location: 1647947..1706424
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DV160_RS09780 - 1648241..1649080 (-) 840 WP_002214477.1 hypothetical protein -
  DV160_RS09785 - 1649121..1650128 (+) 1008 WP_002220741.1 IS5 family transposase -
  DV160_RS13995 - 1650544..1650675 (+) 132 WP_002217434.1 hypothetical protein -
  DV160_RS09800 - 1650672..1651040 (+) 369 WP_002220735.1 type II toxin-antitoxin system death-on-curing family toxin -
  DV160_RS13555 - 1651056..1651226 (+) 171 WP_164728559.1 hypothetical protein -
  DV160_RS09805 - 1651331..1651969 (+) 639 WP_002244527.1 DUF4760 domain-containing protein -
  DV160_RS09810 - 1652328..1652564 (+) 237 WP_002217439.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  DV160_RS09815 - 1652566..1652913 (+) 348 WP_002217440.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DV160_RS09820 - 1652966..1653475 (-) 510 WP_002220734.1 hypothetical protein -
  DV160_RS09825 - 1653487..1653960 (-) 474 WP_002220733.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  DV160_RS09830 - 1654099..1654374 (-) 276 WP_002217443.1 hypothetical protein -
  DV160_RS09835 - 1654371..1654796 (-) 426 WP_002220721.1 hypothetical protein -
  DV160_RS09840 - 1654860..1655231 (-) 372 WP_002220720.1 hypothetical protein -
  DV160_RS14060 - 1655299..1655505 (-) 207 WP_002217448.1 hypothetical protein -
  DV160_RS09850 - 1655522..1655968 (-) 447 WP_002220718.1 hypothetical protein -
  DV160_RS09855 gpJ 1656039..1660304 (-) 4266 WP_002220717.1 TipJ family phage tail tip protein -
  DV160_RS09860 - 1660440..1661162 (-) 723 WP_002220716.1 tail assembly protein -
  DV160_RS09865 - 1661159..1661914 (-) 756 WP_115425121.1 C40 family peptidase -
  DV160_RS09870 - 1661911..1662633 (-) 723 WP_002217456.1 phage minor tail protein L -
  DV160_RS09875 - 1662693..1662962 (-) 270 WP_002217457.1 phage tail protein -
  DV160_RS09880 - 1662984..1666202 (-) 3219 WP_115425122.1 phage tail length tape measure family protein -
  DV160_RS09885 - 1666195..1666467 (-) 273 WP_002220710.1 DUF1799 domain-containing protein -
  DV160_RS09890 - 1666515..1666826 (-) 312 WP_002220709.1 phage tail assembly chaperone -
  DV160_RS09895 - 1666890..1667531 (-) 642 WP_002220708.1 phage tail protein -
  DV160_RS09900 - 1667563..1667982 (-) 420 WP_002244524.1 hypothetical protein -
  DV160_RS09905 - 1667963..1668265 (-) 303 WP_002244523.1 head-tail joining protein -
  DV160_RS09910 - 1668258..1668485 (-) 228 WP_002220705.1 hypothetical protein -
  DV160_RS09915 - 1668543..1670435 (-) 1893 WP_002220704.1 phage major capsid protein -
  DV160_RS09920 - 1670416..1671978 (-) 1563 WP_002220703.1 phage portal protein -
  DV160_RS09925 - 1671987..1672241 (-) 255 WP_002220702.1 hypothetical protein -
  DV160_RS09930 - 1672228..1672614 (-) 387 WP_002220701.1 DUF3310 domain-containing protein -
  DV160_RS09935 - 1672617..1672772 (-) 156 WP_228476387.1 hypothetical protein -
  DV160_RS09940 - 1672843..1675689 (-) 2847 WP_002220699.1 primase-helicase family protein -
  DV160_RS09945 - 1675804..1676151 (-) 348 WP_002220698.1 hypothetical protein -
  DV160_RS09955 - 1676551..1677267 (+) 717 WP_002220696.1 LexA family transcriptional regulator -
  DV160_RS09960 - 1677370..1677795 (+) 426 WP_002220695.1 hypothetical protein -
  DV160_RS09965 - 1678026..1678226 (+) 201 WP_002219431.1 hypothetical protein -
  DV160_RS09970 - 1678294..1678653 (+) 360 WP_002220694.1 hypothetical protein -
  DV160_RS09975 - 1678678..1679532 (+) 855 WP_002220693.1 YfdQ family protein -
  DV160_RS09980 - 1679604..1679819 (+) 216 WP_002220692.1 hypothetical protein -
  DV160_RS09985 - 1679855..1680115 (+) 261 WP_002220690.1 NGO1622 family putative holin -
  DV160_RS09990 - 1680112..1680405 (+) 294 WP_002220689.1 hypothetical protein -
  DV160_RS09995 - 1680408..1680599 (+) 192 WP_002219435.1 type ISP restriction/modification enzyme -
  DV160_RS10000 - 1680599..1680739 (+) 141 WP_002220688.1 hypothetical protein -
  DV160_RS10005 - 1680736..1680945 (+) 210 WP_002220687.1 hypothetical protein -
  DV160_RS10010 - 1681003..1681920 (-) 918 WP_002220686.1 KilA-N domain-containing protein -
  DV160_RS10015 - 1682786..1683298 (-) 513 WP_002220685.1 DUF4760 domain-containing protein -
  DV160_RS10025 - 1683701..1684081 (-) 381 WP_002220683.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DV160_RS10030 - 1684236..1685432 (-) 1197 WP_002224447.1 tyrosine-type recombinase/integrase -
  DV160_RS10045 yaaA 1685964..1686743 (-) 780 WP_002220681.1 peroxide stress protein YaaA -
  DV160_RS14220 - 1686792..1686917 (-) 126 Protein_1630 IS5/IS1182 family transposase -
  DV160_RS10055 dapC 1687005..1688192 (-) 1188 WP_002220680.1 succinyldiaminopimelate transaminase -
  DV160_RS10060 dut 1688268..1688720 (-) 453 WP_002220679.1 dUTP diphosphatase -
  DV160_RS10065 - 1688863..1689291 (+) 429 Protein_1633 AzlC family ABC transporter permease -
  DV160_RS10090 pilX 1691039..1691512 (-) 474 WP_002247808.1 PilX family type IV pilin Machinery gene
  DV160_RS10095 pilK 1691517..1692116 (-) 600 WP_002220676.1 pilus assembly PilX family protein Machinery gene
  DV160_RS10100 pilJ 1692095..1693033 (-) 939 WP_002220674.1 PilW family protein Machinery gene
  DV160_RS10105 pilV 1693030..1693641 (-) 612 WP_002247807.1 type IV pilus modification protein PilV Machinery gene
  DV160_RS10110 pilH 1693665..1694330 (-) 666 WP_115425123.1 GspH/FimT family pseudopilin Machinery gene
  DV160_RS10115 dnaB 1694639..1696045 (-) 1407 WP_002220671.1 replicative DNA helicase -
  DV160_RS10125 - 1696208..1696795 (+) 588 WP_002220670.1 superoxide dismutase -
  DV160_RS10130 - 1697293..1697802 (-) 510 WP_002213852.1 isoprenylcysteine carboxyl methyltransferase family protein -
  DV160_RS10135 - 1698133..1698465 (-) 333 WP_002213854.1 hypothetical protein -
  DV160_RS14225 - 1698510..1698617 (-) 108 Protein_1643 IS5/IS1182 family transposase -
  DV160_RS10140 cysT 1698756..1699592 (+) 837 WP_002224587.1 sulfate ABC transporter permease subunit CysT -
  DV160_RS10145 cysW 1699847..1700707 (+) 861 WP_002220668.1 sulfate ABC transporter permease subunit CysW -
  DV160_RS10150 - 1700704..1701777 (+) 1074 WP_002220667.1 sulfate/molybdate ABC transporter ATP-binding protein -
  DV160_RS10155 ilvA 1701834..1703360 (-) 1527 WP_002220666.1 threonine ammonia-lyase, biosynthetic -
  DV160_RS10165 - 1703508..1704677 (+) 1170 WP_002220665.1 D-alanyl-D-alanine carboxypeptidase family protein -
  DV160_RS10170 - 1704802..1705374 (-) 573 WP_002220664.1 50S ribosomal protein L25/general stress protein Ctc -
  DV160_RS10175 - 1705441..1706424 (-) 984 WP_002213870.1 ribose-phosphate pyrophosphokinase -

Sequence


Protein


Download         Length: 312 a.a.        Molecular weight: 34508.22 Da        Isoelectric Point: 8.7082

>NTDB_id=306082 DV160_RS10100 WP_002220674.1 1692095..1693033(-) (pilJ) [Neisseria meningitidis strain M21717]
MRRKMLNVPKGNYDGMKGFTIIEFLVAGMLSMIVLMAVGSSYFTSRKLNDAANERLSEQQDLRNAATLIVRDARMAGSFG
CFNMSEHPAIDVISDTTQQNSPFSLKRNGIDKLIPIAESSNINYQNFFQFGSALIFQYGIDDVNASTATTVVSSCAVISK
PGKQIPTLEDAKKELKIPQDKEQNGNIARQRHVVNAYAVGRIAGEEGLFRFQLDDKGKWGNPQLLVKKVRRMKVRYIYVF
GCPEDDDAGKEETFKYTDKFDSSTNAVTPAGVEVLLSSGTDTKIAASSDNYIYAYRIDATIRGGNVCANRTL

Nucleotide


Download         Length: 939 bp        

>NTDB_id=306082 DV160_RS10100 WP_002220674.1 1692095..1693033(-) (pilJ) [Neisseria meningitidis strain M21717]
ATGAGACGTAAAATGCTAAACGTACCAAAAGGCAATTATGATGGTATGAAGGGTTTTACCATTATTGAATTTTTGGTTGC
GGGCATGCTCAGTATGATTGTCCTGATGGCGGTCGGATCGAGTTACTTCACATCCCGGAAATTAAATGATGCGGCAAACG
AGCGTCTTTCCGAGCAACAGGATTTGCGGAATGCGGCAACATTGATTGTCCGCGATGCAAGAATGGCGGGGAGCTTCGGT
TGTTTCAATATGTCCGAGCATCCTGCAATTGATGTTATTTCCGATACGACGCAACAAAATTCTCCTTTTTCCTTAAAAAG
GAACGGTATAGATAAACTTATTCCCATAGCGGAATCTTCAAATATCAATTATCAGAATTTTTTCCAGTTTGGTAGCGCAT
TGATTTTTCAATACGGAATCGATGATGTTAATGCAAGCACCGCGACTACCGTCGTCAGCAGCTGTGCCGTAATATCGAAA
CCGGGCAAGCAAATCCCTACTTTAGAAGATGCAAAAAAAGAATTGAAGATTCCGCAGGATAAGGAGCAAAATGGCAATAT
AGCGCGTCAAAGGCATGTGGTCAATGCCTATGCGGTCGGCAGGATTGCCGGTGAGGAAGGTTTGTTCCGCTTCCAATTGG
ATGATAAGGGCAAGTGGGGTAATCCTCAGTTGCTCGTGAAAAAGGTTAGACGTATGAAAGTGCGGTATATCTATGTTTTC
GGCTGTCCTGAAGATGACGATGCCGGCAAAGAGGAAACATTCAAATATACGGATAAATTCGACAGCTCCACAAATGCTGT
TACGCCCGCCGGGGTGGAGGTTTTATTGAGTAGCGGTACTGATACCAAGATTGCCGCTTCTTCAGACAATTATATTTATG
CTTACCGTATCGATGCGACAATACGCGGGGGAAATGTATGCGCAAACAGAACACTTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilJ Neisseria gonorrhoeae MS11

83.544

100

0.846


Multiple sequence alignment