Detailed information    

insolico Bioinformatically predicted

Overview

Name   recX   Type   Regulator
Locus tag   DV445_RS08625 Genome accession   NZ_CP031255
Coordinates   1703834..1704283 (-) Length   149 a.a.
NCBI ID   WP_114922170.1    Uniprot ID   -
Organism   Neisseria elongata strain M15910     
Function   inhibition of RecA (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1694116..1739377 1703834..1704283 within 0


Gene organization within MGE regions


Location: 1694116..1739377
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DV445_RS08580 - 1694116..1694679 (-) 564 WP_114922164.1 hypothetical protein -
  DV445_RS08585 - 1694690..1695613 (-) 924 WP_114922165.1 hypothetical protein -
  DV445_RS08590 - 1695606..1696976 (-) 1371 WP_240318138.1 DUF2345 domain-containing protein -
  DV445_RS08595 - 1696963..1697320 (-) 358 Protein_1670 transposase -
  DV445_RS08600 - 1697360..1697911 (-) 552 WP_114922166.1 hypothetical protein -
  DV445_RS08605 - 1697935..1699401 (-) 1467 WP_114922167.1 LysM peptidoglycan-binding domain-containing protein -
  DV445_RS08610 - 1699401..1701905 (-) 2505 WP_114922168.1 type VI secretion system Vgr family protein -
  DV445_RS08615 - 1702120..1702772 (+) 653 Protein_1674 IS1595 family transposase -
  DV445_RS08620 - 1702866..1703687 (-) 822 WP_114922169.1 symmetrical bis(5'-nucleosyl)-tetraphosphatase -
  DV445_RS08625 recX 1703834..1704283 (-) 450 WP_114922170.1 recombination regulator RecX Regulator
  DV445_RS08630 - 1704364..1705080 (-) 717 WP_107853758.1 phosphoglycolate phosphatase -
  DV445_RS08635 - 1705164..1705868 (-) 705 WP_114922171.1 5'-methylthioadenosine/adenosylhomocysteine nucleosidase -
  DV445_RS08640 - 1705888..1706367 (-) 480 WP_003771718.1 S-ribosylhomocysteine lyase -
  DV445_RS08645 cas2 1708507..1708800 (-) 294 WP_003685729.1 CRISPR-associated endonuclease Cas2 -
  DV445_RS08650 cas1c 1708875..1709888 (-) 1014 WP_114922172.1 type I-C CRISPR-associated endonuclease Cas1c -
  DV445_RS08655 - 1709918..1711672 (-) 1755 WP_114922173.1 ATP-dependent nuclease -
  DV445_RS08660 cas4 1711693..1712340 (-) 648 WP_114922174.1 CRISPR-associated protein Cas4 -
  DV445_RS08665 cas7c 1712356..1713222 (-) 867 WP_114922175.1 type I-C CRISPR-associated protein Cas7/Csd2 -
  DV445_RS08670 cas8c 1713234..1715015 (-) 1782 WP_114922176.1 type I-C CRISPR-associated protein Cas8c/Csd1 -
  DV445_RS08675 cas5c 1715012..1715686 (-) 675 WP_114922177.1 type I-C CRISPR-associated protein Cas5c -
  DV445_RS08680 - 1715763..1717202 (-) 1440 WP_205277229.1 SIR2 family protein -
  DV445_RS08685 - 1717260..1717757 (-) 498 WP_114922179.1 toll/interleukin-1 receptor domain-containing protein -
  DV445_RS08690 - 1717770..1718387 (-) 618 WP_114922180.1 TIR domain-containing protein -
  DV445_RS08695 cas3 1718470..1720752 (-) 2283 WP_114922181.1 CRISPR-associated helicase Cas3' -
  DV445_RS08700 - 1720990..1721862 (-) 873 WP_114922182.1 DUF4184 family protein -
  DV445_RS08705 - 1722004..1722453 (-) 450 WP_114922183.1 DUF4149 domain-containing protein -
  DV445_RS08710 - 1722524..1723909 (-) 1386 WP_114922184.1 MFS transporter -
  DV445_RS13015 - 1723975..1724112 (-) 138 WP_162817652.1 hypothetical protein -
  DV445_RS08715 - 1724253..1724783 (-) 531 WP_107886077.1 RDD family protein -
  DV445_RS08720 miaA 1725039..1725977 (-) 939 WP_114922186.1 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA -
  DV445_RS08725 panC 1726174..1727010 (+) 837 WP_114922187.1 pantoate--beta-alanine ligase -
  DV445_RS08730 pip 1727068..1728003 (+) 936 WP_114922188.1 prolyl aminopeptidase -
  DV445_RS08740 - 1728162..1729376 (+) 1215 WP_003771762.1 pyridoxal phosphate-dependent aminotransferase -
  DV445_RS08745 cysI 1729466..1731235 (-) 1770 WP_114922190.1 assimilatory sulfite reductase (NADPH) hemoprotein subunit -
  DV445_RS08750 secA 1731451..1734216 (+) 2766 WP_049250294.1 preprotein translocase subunit SecA -
  DV445_RS08755 - 1734542..1735774 (-) 1233 WP_074895877.1 HlyD family type I secretion periplasmic adaptor subunit -
  DV445_RS08760 - 1735879..1738026 (-) 2148 WP_107853739.1 type I secretion system permease/ATPase -
  DV445_RS08765 - 1738091..1739377 (-) 1287 WP_107853738.1 TolC family protein -

Sequence

Protein


Download         Length: 149 a.a.        Molecular weight: 17413.62 Da        Isoelectric Point: 8.0607

>NTDB_id=305137 DV445_RS08625 WP_114922170.1 1703834..1704283(-) (recX) [Neisseria elongata strain M15910]
MNPQKTLRARALDILSRQEISRAELKRKLAPHAESEEEIERVLNEFTDRRWQSDERYAEAYIHSKSRKHGSLRLKQALAQ
KGVDEETVCAFLPDRDNELASAVEVVRKKFKHPPADYAEKLKQMRFLAYRGFDGDTVQTALRQAWTEEE

Nucleotide


Download         Length: 450 bp        

>NTDB_id=305137 DV445_RS08625 WP_114922170.1 1703834..1704283(-) (recX) [Neisseria elongata strain M15910]
ATGAACCCGCAGAAAACCCTCCGCGCCCGCGCACTCGACATCCTTTCACGGCAGGAAATCAGTCGTGCCGAACTCAAGCG
CAAACTTGCCCCGCATGCCGAGAGCGAAGAGGAAATTGAGCGCGTGCTGAACGAATTCACCGACCGCCGCTGGCAGTCCG
ACGAACGCTATGCAGAAGCCTATATCCACAGCAAAAGCCGCAAACACGGCTCATTGCGGCTGAAACAGGCTTTGGCACAA
AAGGGCGTGGACGAAGAAACCGTGTGCGCCTTCCTGCCCGACCGCGACAACGAATTGGCTTCCGCCGTAGAAGTGGTGCG
CAAAAAATTCAAACACCCGCCCGCCGACTATGCCGAAAAACTCAAACAGATGCGCTTTTTGGCTTATCGCGGCTTCGACG
GCGACACCGTTCAGACGGCCTTAAGGCAGGCCTGGACGGAAGAAGAATAG

Domains

Predicted by InterproScan.

RecX family (RecX_HTH2)

(30-146)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  recX Neisseria gonorrhoeae strain FA1090

74.15

98.658

0.732

Multiple sequence alignment