Detailed information    

experimental Experimentally validated

Overview

Name   recX   Type   Regulator
Locus tag   OK783_RS05295 Genome accession   NZ_CP115654
Coordinates   1013481..1013942 (+) Length   153 a.a.
NCBI ID   WP_003688187.1    Uniprot ID   A0AA44U815
Organism   Neisseria gonorrhoeae strain FA1090     
Function   inhibition of RecA   
Competence regulation

Function

The recX loss-of-function mutant showed decreases in pilus phase variation, DNA transformation and DNA repair ability compared with wild type. A series of RecX(Ng) mutant proteins representing a gradient of functional deficiencies provide a direct correlation between RecA(Ng) inhibition in vitro and the enhancement of RecA(Ng) function in N. gonorrhoeae. Unlike RecX(Ec), RecX(Ng) does not simply cap the growing ends of RecA filaments, but it directly facilitates a more rapid RecA filament disassembly.


Genomic Context

Location: 1008481..1018942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OK783_RS05260 (OK783_05260) - 1008514..1009728 (-) 1215 WP_003695054.1 pyridoxal phosphate-dependent aminotransferase -
  OK783_RS05265 (OK783_05265) - 1009817..1010026 (-) 210 WP_003688192.1 tautomerase family protein -
  OK783_RS05270 (OK783_05270) - 1010218..1011024 (+) 807 WP_003695051.1 DUF4198 domain-containing protein -
  OK783_RS11420 - 1011084..1012303 (-) 1220 Protein_1023 Glu/Leu/Phe/Val family dehydrogenase -
  OK783_RS05290 (OK783_05290) - 1012698..1013408 (+) 711 WP_003688188.1 phosphoglycolate phosphatase -
  OK783_RS05295 (OK783_05295) recX 1013481..1013942 (+) 462 WP_003688187.1 recombination regulator RecX Regulator
  OK783_RS05300 (OK783_05300) - 1014016..1014177 (+) 162 WP_010358395.1 hypothetical protein -
  OK783_RS05305 (OK783_05305) - 1014330..1014812 (+) 483 WP_003688183.1 acyl-CoA thioesterase -
  OK783_RS05310 (OK783_05310) - 1015210..1016223 (-) 1014 WP_020996850.1 peptidoglycan DD-metalloendopeptidase family protein -
  OK783_RS05315 (OK783_05315) surE 1016325..1017071 (-) 747 WP_003688178.1 5'/3'-nucleotidase SurE -
  OK783_RS05320 (OK783_05320) - 1017088..1018644 (-) 1557 WP_003706387.1 TerC family protein -

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  recX recA negative effect

Sequence

Protein


Download         Length: 153 a.a.        Molecular weight: 17745.13 Da        Isoelectric Point: 10.4361

>NTDB_id=1135 OK783_RS05295 WP_003688187.1 1013481..1013942(+) (recX) [Neisseria gonorrhoeae strain FA1090]
MKPQKSLRARAMDILSRQEVSRIGLKRKLAPHAESEEELENVLNEFAERNWQSDLRYAEAYIRSKSRKHGSLRLKQALAQ
QGIDEKTSRNLLPDRSSEKQAAIAVLRKKFKHPAANLKEKQKQARFLAYRGFDADTVQTALKHAWDENWEDSC

Nucleotide


Download         Length: 462 bp        

>NTDB_id=1135 OK783_RS05295 WP_003688187.1 1013481..1013942(+) (recX) [Neisseria gonorrhoeae strain FA1090]
ATGAAACCGCAAAAATCCCTACGCGCCCGCGCGATGGACATCCTCTCGCGCCAAGAAGTCAGCCGCATCGGTCTGAAACG
CAAACTTGCACCGCACGCCGAAAGCGAAGAGGAGTTGGAAAACGTGTTAAACGAATTTGCCGAACGCAACTGGCAGTCGG
ATTTGCGCTACGCCGAAGCCTATATCCGCAGCAAAAGCCGCAAACACGGTTCATTGAGGCTGAAACAGGCTTTGGCGCAA
CAGGGCATAGATGAAAAAACCAGCCGCAACCTGCTTCCCGACCGCTCAAGCGAAAAGCAAGCCGCCATAGCCGTGTTGCG
TAAAAAATTCAAACATCCCGCCGCCAACCTCAAAGAAAAACAAAAACAGGCGCGTTTCCTCGCCTATCGCGGTTTTGATG
CCGATACCGTTCAGACGGCATTGAAACACGCTTGGGACGAAAATTGGGAAGACAGCTGCTGA

Domains

Predicted by InterproScan.

RecX family (RecX_HTH2)

(30-143)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Marielle C Gruenig et al. (2010) Less is more: Neisseria gonorrhoeae RecX protein stimulates recombination by inhibiting RecA. The Journal of Biological Chemistry 285(48):37188-97. [PMID: 20851893]
[2] E A Stohl et al. (2001) The recX gene potentiates homologous recombination in Neisseria gonorrhoeae. Molecular Microbiology 40(6):1301-10. [PMID: 11442829]