Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   DV130_RS05095 Genome accession   NZ_CP031248
Coordinates   977175..977324 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain M26365     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 978191..978976 977175..977324 flank 867


Gene organization within MGE regions


Location: 977175..978976
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DV130_RS05095 cipB 977175..977324 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  DV130_RS05105 blpN 977568..977771 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  DV130_RS05110 blpM 977787..978041 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  DV130_RS05115 - 978191..978976 (-) 786 Protein_994 IS5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=304838 DV130_RS05095 WP_001818346.1 977175..977324(-) (cipB) [Streptococcus pneumoniae strain M26365]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=304838 DV130_RS05095 WP_001818346.1 977175..977324(-) (cipB) [Streptococcus pneumoniae strain M26365]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment