Detailed information NTG0304714

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: DV131_RS05650
• Genome accession: NZ_CP031246
• Coordinates: 1036124..1036273 (+)
• Length: 49 a.a.
• NCBI ID: WP_001809846.1
• Uniprot ID: Q00MV6
• Organism: Streptococcus pneumoniae strain M26368
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Genomic Context

Location: 1031124..1041273

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DV131_RS05620	blpC	1031418..1031573 (-)	156	WP_000358817.1	quorum-sensing system pheromone BlpC	-
DV131_RS05625	-	1031630..1032991 (-)	1362	WP_050213945.1	bacteriocin secretion accessory protein	-
DV131_RS05630	blpA	1033002..1035127 (-)	2126	Protein_1021	peptide cleavage/export ABC transporter BlpA	-
DV131_RS05635	blpM	1035407..1035661 (+)	255	WP_054382973.1	two-peptide bacteriocin subunit BlpM	-
DV131_RS05640	blpN	1035677..1035880 (+)	204	WP_001099490.1	two-peptide bacteriocin subunit BlpN	-
DV131_RS05650	cipB	1036124..1036273 (+)	150	WP_001809846.1	bacteriocin-like peptide BlpO	Regulator
DV131_RS05655	-	1036377..1036496 (+)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
DV131_RS11490	-	1036794..1036955 (+)	162	WP_000727120.1	hypothetical protein	-
DV131_RS05665	-	1037017..1037336 (+)	320	Protein_1027	immunity protein	-
DV131_RS05675	-	1037965..1038348 (+)	384	WP_000877381.1	hypothetical protein	-
DV131_RS05680	-	1038400..1039089 (+)	690	WP_114865887.1	CPBP family intramembrane glutamic endopeptidase	-
DV131_RS05685	blpZ	1039131..1039379 (+)	249	WP_000276502.1	immunity protein BlpZ	-
DV131_RS05690	-	1039409..1040020 (+)	612	WP_000394027.1	type II CAAX endopeptidase family protein	-
DV131_RS05695	-	1040182..1040976 (+)	795	WP_000363002.1	phosphotransferase family protein	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5149.92 Da
• Isoelectric Point: 4.0439

>NTDB_id=304714 DV131_RS05650 WP_001809846.1 1036124..1036273(+) (cipB) [Streptococcus pneumoniae strain M26368]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=304714 DV131_RS05650 WP_001809846.1 1036124..1036273(+) (cipB) [Streptococcus pneumoniae strain M26368]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

3D structure

• AlphaFold DB: Q00MV6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	53.061	100	0.531