Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT48_RS00680 Genome accession   NZ_CP035451
Coordinates   104509..104793 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm230     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99509..109793
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT48_RS00655 (ETT48_00655) - 101455..101820 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT48_RS00660 (ETT48_00660) comGA 101913..102851 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT48_RS00665 (ETT48_00665) comGB 102787..103821 (+) 1035 WP_227869504.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT48_RS00670 (ETT48_00670) comGC 103823..104149 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT48_RS00675 (ETT48_00675) comGD 104124..104552 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT48_RS00680 (ETT48_00680) comGE 104509..104793 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT48_RS00685 (ETT48_00685) comGF 104786..105220 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT48_RS00690 (ETT48_00690) comGG 105204..105530 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  ETT48_RS00695 (ETT48_00695) comGH 105628..106581 (+) 954 WP_023610092.1 class I SAM-dependent methyltransferase Machinery gene
  ETT48_RS00700 (ETT48_00700) - 106640..107836 (+) 1197 WP_002992742.1 acetate kinase -
  ETT48_RS00705 (ETT48_00705) - 108023..108331 (+) 309 WP_032467031.1 hypothetical protein -
  ETT48_RS00710 (ETT48_00710) proC 108414..109184 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=303135 ETT48_RS00680 WP_011284422.1 104509..104793(+) (comGE) [Streptococcus pyogenes strain emm230]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=303135 ETT48_RS00680 WP_011284422.1 104509..104793(+) (comGE) [Streptococcus pyogenes strain emm230]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383