Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiD   Type   Regulator
Locus tag   DTA40_RS06830 Genome accession   NZ_CP030928
Coordinates   1318474..1319400 (-) Length   308 a.a.
NCBI ID   WP_002946409.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain CS18     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1300926..1371959 1318474..1319400 within 0


Gene organization within MGE regions


Location: 1300926..1371959
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DTA40_RS06745 (DTA40_06965) liaF 1300934..1301632 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  DTA40_RS10080 - 1301887..1302054 (-) 168 WP_014608530.1 potassium channel family protein -
  DTA40_RS06755 (DTA40_06975) stkP/pknB 1302692..1304563 (-) 1872 WP_024703938.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  DTA40_RS06760 (DTA40_06980) - 1304563..1305300 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  DTA40_RS06765 (DTA40_06985) rsmB 1305344..1306666 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  DTA40_RS06770 (DTA40_06990) fmt 1306656..1307591 (-) 936 WP_014608534.1 methionyl-tRNA formyltransferase -
  DTA40_RS06775 (DTA40_06995) - 1307609..1310005 (-) 2397 WP_024703939.1 primosomal protein N' -
  DTA40_RS06780 (DTA40_07000) rpoZ 1310147..1310461 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  DTA40_RS06785 (DTA40_07005) gmk 1310483..1311112 (-) 630 WP_014608537.1 guanylate kinase -
  DTA40_RS06790 (DTA40_07010) ftsY 1311338..1312729 (-) 1392 WP_014608538.1 signal recognition particle-docking protein FtsY -
  DTA40_RS06795 (DTA40_07015) - 1312743..1313558 (-) 816 WP_011226298.1 Cof-type HAD-IIB family hydrolase -
  DTA40_RS06800 (DTA40_07020) - 1313551..1314345 (-) 795 WP_011681412.1 HAD-IIB family hydrolase -
  DTA40_RS06805 (DTA40_07025) - 1314530..1314907 (+) 378 WP_011681413.1 GntR family transcriptional regulator -
  DTA40_RS06810 (DTA40_07030) - 1314912..1315610 (+) 699 WP_023909821.1 ABC transporter ATP-binding protein -
  DTA40_RS06815 (DTA40_07035) - 1315622..1316407 (+) 786 WP_002951425.1 hypothetical protein -
  DTA40_RS06820 (DTA40_07040) amiF 1316457..1317386 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  DTA40_RS06825 (DTA40_07045) amiE 1317379..1318464 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  DTA40_RS06830 (DTA40_07050) amiD 1318474..1319400 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  DTA40_RS06835 (DTA40_07055) amiC 1319400..1320893 (-) 1494 WP_011681416.1 ABC transporter permease Regulator
  DTA40_RS06840 (DTA40_07060) amiA 1320955..1322922 (-) 1968 WP_024703940.1 peptide ABC transporter substrate-binding protein Regulator
  DTA40_RS09730 (DTA40_07065) - 1323278..1324455 (+) 1178 Protein_1302 ISL3 family transposase -
  DTA40_RS06850 (DTA40_07070) amiA3 1324500..1326473 (-) 1974 WP_011681419.1 peptide ABC transporter substrate-binding protein Regulator
  DTA40_RS06855 (DTA40_07075) - 1326778..1327925 (+) 1148 WP_095559415.1 IS3 family transposase -
  DTA40_RS06860 (DTA40_07080) - 1327963..1328147 (-) 185 Protein_1305 IS3 family transposase -
  DTA40_RS10085 - 1328141..1328542 (-) 402 Protein_1306 ATP-binding cassette domain-containing protein -
  DTA40_RS06875 (DTA40_07095) - 1328537..1328897 (-) 361 Protein_1307 TatD family hydrolase -
  DTA40_RS06880 (DTA40_07100) - 1329243..1330448 (+) 1206 WP_011681420.1 OFA family MFS transporter -
  DTA40_RS06885 (DTA40_07105) - 1330494..1331807 (-) 1314 Protein_1309 IS3 family transposase -
  DTA40_RS06890 (DTA40_07110) pta 1331932..1332915 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  DTA40_RS06895 (DTA40_07115) - 1332929..1333825 (-) 897 WP_024703943.1 RluA family pseudouridine synthase -
  DTA40_RS06900 (DTA40_07120) - 1333822..1334658 (-) 837 WP_014608552.1 NAD kinase -
  DTA40_RS06905 (DTA40_07125) - 1334630..1335304 (-) 675 WP_011681427.1 GTP pyrophosphokinase family protein -
  DTA40_RS06910 (DTA40_07130) - 1335400..1335975 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  DTA40_RS06915 (DTA40_07135) - 1336338..1337309 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  DTA40_RS06920 (DTA40_07140) - 1337313..1338425 (+) 1113 WP_014608554.1 cysteine desulfurase family protein -
  DTA40_RS06925 (DTA40_07145) - 1338427..1338774 (+) 348 WP_014608555.1 DUF1831 domain-containing protein -
  DTA40_RS06930 (DTA40_07150) - 1338918..1339577 (+) 660 WP_024703944.1 redox-sensing transcriptional repressor Rex -
  DTA40_RS06935 (DTA40_07155) - 1339570..1340265 (+) 696 WP_024703945.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  DTA40_RS06940 (DTA40_07160) radC 1340318..1341004 (-) 687 WP_014727630.1 DNA repair protein RadC -
  DTA40_RS06945 (DTA40_07165) - 1341053..1342837 (-) 1785 WP_024703946.1 rhamnan synthesis F family protein -
  DTA40_RS06950 (DTA40_07170) - 1342834..1343901 (-) 1068 WP_024703947.1 glycosyltransferase -
  DTA40_RS06955 (DTA40_07175) - 1343921..1345126 (-) 1206 WP_014727633.1 ABC transporter ATP-binding protein -
  DTA40_RS06960 (DTA40_07180) - 1345126..1345935 (-) 810 WP_024703948.1 ABC transporter permease -
  DTA40_RS06965 (DTA40_07185) - 1345919..1346875 (-) 957 WP_024703949.1 glycosyltransferase family 2 protein -
  DTA40_RS06970 (DTA40_07190) cps2T 1346872..1348020 (-) 1149 WP_024703950.1 beta 1-4 rhamnosyltransferase Cps2T -
  DTA40_RS06975 (DTA40_07195) - 1348127..1349668 (-) 1542 WP_024703951.1 DUF2142 domain-containing protein -
  DTA40_RS06980 (DTA40_07200) - 1349675..1350685 (-) 1011 WP_024703952.1 glycosyltransferase -
  DTA40_RS06985 (DTA40_07205) - 1350685..1351959 (-) 1275 WP_024703953.1 lipopolysaccharide biosynthesis protein -
  DTA40_RS06990 (DTA40_07210) - 1351952..1352284 (-) 333 WP_011226332.1 DUF2304 domain-containing protein -
  DTA40_RS06995 (DTA40_07215) - 1352290..1352985 (-) 696 WP_024703954.1 glycosyltransferase family 2 protein -
  DTA40_RS07000 (DTA40_07220) rfbD 1353062..1353913 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  DTA40_RS07005 (DTA40_07225) - 1353990..1355324 (-) 1335 WP_024703955.1 DUF6056 family protein -
  DTA40_RS07010 (DTA40_07230) - 1355437..1356363 (-) 927 WP_024703956.1 glycosyltransferase family 2 protein -
  DTA40_RS07015 (DTA40_07235) - 1356373..1356708 (-) 336 WP_024703957.1 metal-sulfur cluster assembly factor -
  DTA40_RS07020 (DTA40_07240) rpoD 1356762..1357871 (-) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  DTA40_RS07025 (DTA40_07245) dnaG 1357875..1359686 (-) 1812 WP_024703958.1 DNA primase -
  DTA40_RS07030 (DTA40_07250) mscL 1359826..1359909 (+) 84 Protein_1338 large conductance mechanosensitive channel protein MscL -
  DTA40_RS07035 (DTA40_07255) rpsU 1360069..1360245 (-) 177 WP_011681449.1 30S ribosomal protein S21 -
  DTA40_RS07040 (DTA40_07260) - 1360439..1361233 (-) 795 WP_023909836.1 ABC transporter substrate-binding protein -
  DTA40_RS07045 (DTA40_07265) - 1361295..1362404 (-) 1110 WP_024703959.1 aminotransferase -
  DTA40_RS07050 (DTA40_07270) - 1362752..1363549 (-) 798 WP_014621828.1 transporter substrate-binding domain-containing protein -
  DTA40_RS07055 (DTA40_07275) - 1363546..1364376 (-) 831 WP_014621829.1 transporter substrate-binding domain-containing protein -
  DTA40_RS07060 (DTA40_07280) - 1364590..1365054 (-) 465 WP_011681454.1 8-oxo-dGTP diphosphatase -
  DTA40_RS07065 (DTA40_07285) uvrB 1365099..1367090 (-) 1992 WP_014608579.1 excinuclease ABC subunit UvrB -
  DTA40_RS07070 (DTA40_07290) - 1367237..1367704 (-) 468 WP_014608580.1 hypothetical protein -
  DTA40_RS07075 (DTA40_07295) - 1367777..1368713 (-) 937 Protein_1347 CPBP family intramembrane glutamic endopeptidase -
  DTA40_RS07080 (DTA40_07300) - 1368912..1371122 (+) 2211 WP_014727645.1 ABC transporter substrate-binding protein/permease -
  DTA40_RS07085 (DTA40_07305) - 1371122..1371862 (+) 741 WP_024703961.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 308 a.a.        Molecular weight: 34694.85 Da        Isoelectric Point: 9.7054

>NTDB_id=302434 DTA40_RS06830 WP_002946409.1 1318474..1319400(-) (amiD) [Streptococcus thermophilus strain CS18]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR

Nucleotide


Download         Length: 927 bp        

>NTDB_id=302434 DTA40_RS06830 WP_002946409.1 1318474..1319400(-) (amiD) [Streptococcus thermophilus strain CS18]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiD Streptococcus thermophilus LMG 18311

100

100

1

  amiD Streptococcus thermophilus LMD-9

100

100

1

  amiD Streptococcus salivarius strain HSISS4

96.429

100

0.964


Multiple sequence alignment