Detailed information
Overview
| Name | amiD | Type | Regulator |
| Locus tag | DTA40_RS06830 | Genome accession | NZ_CP030928 |
| Coordinates | 1318474..1319400 (-) | Length | 308 a.a. |
| NCBI ID | WP_002946409.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS18 | ||
| Function | internalize XIP (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1300926..1371959 | 1318474..1319400 | within | 0 |
Gene organization within MGE regions
Location: 1300926..1371959
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DTA40_RS06745 (DTA40_06965) | liaF | 1300934..1301632 (-) | 699 | WP_011226289.1 | cell wall-active antibiotics response protein LiaF | - |
| DTA40_RS10080 | - | 1301887..1302054 (-) | 168 | WP_014608530.1 | potassium channel family protein | - |
| DTA40_RS06755 (DTA40_06975) | stkP/pknB | 1302692..1304563 (-) | 1872 | WP_024703938.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | Regulator |
| DTA40_RS06760 (DTA40_06980) | - | 1304563..1305300 (-) | 738 | WP_002946881.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| DTA40_RS06765 (DTA40_06985) | rsmB | 1305344..1306666 (-) | 1323 | WP_014608533.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| DTA40_RS06770 (DTA40_06990) | fmt | 1306656..1307591 (-) | 936 | WP_014608534.1 | methionyl-tRNA formyltransferase | - |
| DTA40_RS06775 (DTA40_06995) | - | 1307609..1310005 (-) | 2397 | WP_024703939.1 | primosomal protein N' | - |
| DTA40_RS06780 (DTA40_07000) | rpoZ | 1310147..1310461 (-) | 315 | WP_002951415.1 | DNA-directed RNA polymerase subunit omega | - |
| DTA40_RS06785 (DTA40_07005) | gmk | 1310483..1311112 (-) | 630 | WP_014608537.1 | guanylate kinase | - |
| DTA40_RS06790 (DTA40_07010) | ftsY | 1311338..1312729 (-) | 1392 | WP_014608538.1 | signal recognition particle-docking protein FtsY | - |
| DTA40_RS06795 (DTA40_07015) | - | 1312743..1313558 (-) | 816 | WP_011226298.1 | Cof-type HAD-IIB family hydrolase | - |
| DTA40_RS06800 (DTA40_07020) | - | 1313551..1314345 (-) | 795 | WP_011681412.1 | HAD-IIB family hydrolase | - |
| DTA40_RS06805 (DTA40_07025) | - | 1314530..1314907 (+) | 378 | WP_011681413.1 | GntR family transcriptional regulator | - |
| DTA40_RS06810 (DTA40_07030) | - | 1314912..1315610 (+) | 699 | WP_023909821.1 | ABC transporter ATP-binding protein | - |
| DTA40_RS06815 (DTA40_07035) | - | 1315622..1316407 (+) | 786 | WP_002951425.1 | hypothetical protein | - |
| DTA40_RS06820 (DTA40_07040) | amiF | 1316457..1317386 (-) | 930 | WP_002951426.1 | ATP-binding cassette domain-containing protein | Regulator |
| DTA40_RS06825 (DTA40_07045) | amiE | 1317379..1318464 (-) | 1086 | WP_011226304.1 | ABC transporter ATP-binding protein | Regulator |
| DTA40_RS06830 (DTA40_07050) | amiD | 1318474..1319400 (-) | 927 | WP_002946409.1 | oligopeptide ABC transporter permease OppC | Regulator |
| DTA40_RS06835 (DTA40_07055) | amiC | 1319400..1320893 (-) | 1494 | WP_011681416.1 | ABC transporter permease | Regulator |
| DTA40_RS06840 (DTA40_07060) | amiA | 1320955..1322922 (-) | 1968 | WP_024703940.1 | peptide ABC transporter substrate-binding protein | Regulator |
| DTA40_RS09730 (DTA40_07065) | - | 1323278..1324455 (+) | 1178 | Protein_1302 | ISL3 family transposase | - |
| DTA40_RS06850 (DTA40_07070) | amiA3 | 1324500..1326473 (-) | 1974 | WP_011681419.1 | peptide ABC transporter substrate-binding protein | Regulator |
| DTA40_RS06855 (DTA40_07075) | - | 1326778..1327925 (+) | 1148 | WP_095559415.1 | IS3 family transposase | - |
| DTA40_RS06860 (DTA40_07080) | - | 1327963..1328147 (-) | 185 | Protein_1305 | IS3 family transposase | - |
| DTA40_RS10085 | - | 1328141..1328542 (-) | 402 | Protein_1306 | ATP-binding cassette domain-containing protein | - |
| DTA40_RS06875 (DTA40_07095) | - | 1328537..1328897 (-) | 361 | Protein_1307 | TatD family hydrolase | - |
| DTA40_RS06880 (DTA40_07100) | - | 1329243..1330448 (+) | 1206 | WP_011681420.1 | OFA family MFS transporter | - |
| DTA40_RS06885 (DTA40_07105) | - | 1330494..1331807 (-) | 1314 | Protein_1309 | IS3 family transposase | - |
| DTA40_RS06890 (DTA40_07110) | pta | 1331932..1332915 (-) | 984 | WP_011227420.1 | phosphate acetyltransferase | - |
| DTA40_RS06895 (DTA40_07115) | - | 1332929..1333825 (-) | 897 | WP_024703943.1 | RluA family pseudouridine synthase | - |
| DTA40_RS06900 (DTA40_07120) | - | 1333822..1334658 (-) | 837 | WP_014608552.1 | NAD kinase | - |
| DTA40_RS06905 (DTA40_07125) | - | 1334630..1335304 (-) | 675 | WP_011681427.1 | GTP pyrophosphokinase family protein | - |
| DTA40_RS06910 (DTA40_07130) | - | 1335400..1335975 (+) | 576 | WP_002951444.1 | CYTH domain-containing protein | - |
| DTA40_RS06915 (DTA40_07135) | - | 1336338..1337309 (+) | 972 | WP_002951446.1 | ribose-phosphate diphosphokinase | - |
| DTA40_RS06920 (DTA40_07140) | - | 1337313..1338425 (+) | 1113 | WP_014608554.1 | cysteine desulfurase family protein | - |
| DTA40_RS06925 (DTA40_07145) | - | 1338427..1338774 (+) | 348 | WP_014608555.1 | DUF1831 domain-containing protein | - |
| DTA40_RS06930 (DTA40_07150) | - | 1338918..1339577 (+) | 660 | WP_024703944.1 | redox-sensing transcriptional repressor Rex | - |
| DTA40_RS06935 (DTA40_07155) | - | 1339570..1340265 (+) | 696 | WP_024703945.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| DTA40_RS06940 (DTA40_07160) | radC | 1340318..1341004 (-) | 687 | WP_014727630.1 | DNA repair protein RadC | - |
| DTA40_RS06945 (DTA40_07165) | - | 1341053..1342837 (-) | 1785 | WP_024703946.1 | rhamnan synthesis F family protein | - |
| DTA40_RS06950 (DTA40_07170) | - | 1342834..1343901 (-) | 1068 | WP_024703947.1 | glycosyltransferase | - |
| DTA40_RS06955 (DTA40_07175) | - | 1343921..1345126 (-) | 1206 | WP_014727633.1 | ABC transporter ATP-binding protein | - |
| DTA40_RS06960 (DTA40_07180) | - | 1345126..1345935 (-) | 810 | WP_024703948.1 | ABC transporter permease | - |
| DTA40_RS06965 (DTA40_07185) | - | 1345919..1346875 (-) | 957 | WP_024703949.1 | glycosyltransferase family 2 protein | - |
| DTA40_RS06970 (DTA40_07190) | cps2T | 1346872..1348020 (-) | 1149 | WP_024703950.1 | beta 1-4 rhamnosyltransferase Cps2T | - |
| DTA40_RS06975 (DTA40_07195) | - | 1348127..1349668 (-) | 1542 | WP_024703951.1 | DUF2142 domain-containing protein | - |
| DTA40_RS06980 (DTA40_07200) | - | 1349675..1350685 (-) | 1011 | WP_024703952.1 | glycosyltransferase | - |
| DTA40_RS06985 (DTA40_07205) | - | 1350685..1351959 (-) | 1275 | WP_024703953.1 | lipopolysaccharide biosynthesis protein | - |
| DTA40_RS06990 (DTA40_07210) | - | 1351952..1352284 (-) | 333 | WP_011226332.1 | DUF2304 domain-containing protein | - |
| DTA40_RS06995 (DTA40_07215) | - | 1352290..1352985 (-) | 696 | WP_024703954.1 | glycosyltransferase family 2 protein | - |
| DTA40_RS07000 (DTA40_07220) | rfbD | 1353062..1353913 (-) | 852 | WP_014621820.1 | dTDP-4-dehydrorhamnose reductase | - |
| DTA40_RS07005 (DTA40_07225) | - | 1353990..1355324 (-) | 1335 | WP_024703955.1 | DUF6056 family protein | - |
| DTA40_RS07010 (DTA40_07230) | - | 1355437..1356363 (-) | 927 | WP_024703956.1 | glycosyltransferase family 2 protein | - |
| DTA40_RS07015 (DTA40_07235) | - | 1356373..1356708 (-) | 336 | WP_024703957.1 | metal-sulfur cluster assembly factor | - |
| DTA40_RS07020 (DTA40_07240) | rpoD | 1356762..1357871 (-) | 1110 | WP_011227440.1 | RNA polymerase sigma factor RpoD | - |
| DTA40_RS07025 (DTA40_07245) | dnaG | 1357875..1359686 (-) | 1812 | WP_024703958.1 | DNA primase | - |
| DTA40_RS07030 (DTA40_07250) | mscL | 1359826..1359909 (+) | 84 | Protein_1338 | large conductance mechanosensitive channel protein MscL | - |
| DTA40_RS07035 (DTA40_07255) | rpsU | 1360069..1360245 (-) | 177 | WP_011681449.1 | 30S ribosomal protein S21 | - |
| DTA40_RS07040 (DTA40_07260) | - | 1360439..1361233 (-) | 795 | WP_023909836.1 | ABC transporter substrate-binding protein | - |
| DTA40_RS07045 (DTA40_07265) | - | 1361295..1362404 (-) | 1110 | WP_024703959.1 | aminotransferase | - |
| DTA40_RS07050 (DTA40_07270) | - | 1362752..1363549 (-) | 798 | WP_014621828.1 | transporter substrate-binding domain-containing protein | - |
| DTA40_RS07055 (DTA40_07275) | - | 1363546..1364376 (-) | 831 | WP_014621829.1 | transporter substrate-binding domain-containing protein | - |
| DTA40_RS07060 (DTA40_07280) | - | 1364590..1365054 (-) | 465 | WP_011681454.1 | 8-oxo-dGTP diphosphatase | - |
| DTA40_RS07065 (DTA40_07285) | uvrB | 1365099..1367090 (-) | 1992 | WP_014608579.1 | excinuclease ABC subunit UvrB | - |
| DTA40_RS07070 (DTA40_07290) | - | 1367237..1367704 (-) | 468 | WP_014608580.1 | hypothetical protein | - |
| DTA40_RS07075 (DTA40_07295) | - | 1367777..1368713 (-) | 937 | Protein_1347 | CPBP family intramembrane glutamic endopeptidase | - |
| DTA40_RS07080 (DTA40_07300) | - | 1368912..1371122 (+) | 2211 | WP_014727645.1 | ABC transporter substrate-binding protein/permease | - |
| DTA40_RS07085 (DTA40_07305) | - | 1371122..1371862 (+) | 741 | WP_024703961.1 | amino acid ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 308 a.a. Molecular weight: 34694.85 Da Isoelectric Point: 9.7054
>NTDB_id=302434 DTA40_RS06830 WP_002946409.1 1318474..1319400(-) (amiD) [Streptococcus thermophilus strain CS18]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
Nucleotide
Download Length: 927 bp
>NTDB_id=302434 DTA40_RS06830 WP_002946409.1 1318474..1319400(-) (amiD) [Streptococcus thermophilus strain CS18]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| amiD | Streptococcus thermophilus LMG 18311 |
100 |
100 |
1 |
| amiD | Streptococcus thermophilus LMD-9 |
100 |
100 |
1 |
| amiD | Streptococcus salivarius strain HSISS4 |
96.429 |
100 |
0.964 |