Detailed information
Overview
| Name | amiD | Type | Regulator |
| Locus tag | DR994_RS06910 | Genome accession | NZ_CP030927 |
| Coordinates | 1338851..1339777 (-) | Length | 308 a.a. |
| NCBI ID | WP_002946409.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS9 | ||
| Function | internalize XIP (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1321298..1387747 | 1338851..1339777 | within | 0 |
Gene organization within MGE regions
Location: 1321298..1387747
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DR994_RS06825 (DR994_07005) | liaF | 1321306..1322004 (-) | 699 | WP_011226289.1 | cell wall-active antibiotics response protein LiaF | - |
| DR994_RS10055 | - | 1322259..1322426 (-) | 168 | WP_224103618.1 | potassium channel family protein | - |
| DR994_RS06835 (DR994_07015) | stkP/pknB | 1323063..1324934 (-) | 1872 | WP_173940600.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | Regulator |
| DR994_RS06840 (DR994_07020) | - | 1324934..1325671 (-) | 738 | WP_002946881.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| DR994_RS06845 (DR994_07025) | rsmB | 1325715..1327037 (-) | 1323 | WP_014608533.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| DR994_RS06850 (DR994_07030) | fmt | 1327027..1327962 (-) | 936 | WP_173940601.1 | methionyl-tRNA formyltransferase | - |
| DR994_RS06855 (DR994_07035) | - | 1327980..1330376 (-) | 2397 | WP_011681408.1 | primosomal protein N' | - |
| DR994_RS06860 (DR994_07040) | rpoZ | 1330518..1330832 (-) | 315 | WP_002951415.1 | DNA-directed RNA polymerase subunit omega | - |
| DR994_RS06865 (DR994_07045) | gmk | 1330854..1331483 (-) | 630 | WP_173940602.1 | guanylate kinase | - |
| DR994_RS06870 (DR994_07050) | ftsY | 1331716..1333107 (-) | 1392 | WP_011681410.1 | signal recognition particle-docking protein FtsY | - |
| DR994_RS06875 (DR994_07055) | - | 1333118..1333936 (-) | 819 | WP_011681411.1 | Cof-type HAD-IIB family hydrolase | - |
| DR994_RS06880 (DR994_07060) | - | 1333929..1334723 (-) | 795 | WP_173940603.1 | HAD family hydrolase | - |
| DR994_RS06885 (DR994_07065) | - | 1334907..1335284 (+) | 378 | WP_173940604.1 | GntR family transcriptional regulator | - |
| DR994_RS06890 (DR994_07070) | - | 1335289..1335987 (+) | 699 | WP_173940605.1 | ABC transporter ATP-binding protein | - |
| DR994_RS06895 (DR994_07075) | - | 1335999..1336784 (+) | 786 | WP_173940606.1 | ABC transporter permease | - |
| DR994_RS06900 (DR994_07080) | amiF | 1336834..1337763 (-) | 930 | WP_002951426.1 | ATP-binding cassette domain-containing protein | Regulator |
| DR994_RS06905 (DR994_07085) | amiE | 1337756..1338841 (-) | 1086 | WP_011226304.1 | ABC transporter ATP-binding protein | Regulator |
| DR994_RS06910 (DR994_07090) | amiD | 1338851..1339777 (-) | 927 | WP_002946409.1 | oligopeptide ABC transporter permease OppC | Regulator |
| DR994_RS06915 (DR994_07095) | amiC | 1339777..1341270 (-) | 1494 | WP_002946410.1 | ABC transporter permease | Regulator |
| DR994_RS06920 (DR994_07100) | - | 1341332..1343298 (-) | 1967 | Protein_1331 | peptide ABC transporter substrate-binding protein | - |
| DR994_RS06925 (DR994_07105) | - | 1343502..1343692 (-) | 191 | Protein_1332 | IS3 family transposase | - |
| DR994_RS10355 (DR994_07110) | amiF | 1343683..1343853 (-) | 171 | WP_014608546.1 | hypothetical protein | Regulator |
| DR994_RS10360 (DR994_07115) | amiF | 1343866..1344102 (-) | 237 | WP_308123564.1 | ABC transporter ATP-binding protein | Regulator |
| DR994_RS06940 (DR994_07120) | - | 1344082..1344442 (-) | 361 | Protein_1335 | TatD family hydrolase | - |
| DR994_RS06945 (DR994_07125) | - | 1344791..1345996 (+) | 1206 | WP_011227415.1 | OFA family MFS transporter | - |
| DR994_RS06950 (DR994_07130) | - | 1346043..1347395 (-) | 1353 | Protein_1337 | IS3 family transposase | - |
| DR994_RS06955 (DR994_07135) | pta | 1347481..1348464 (-) | 984 | WP_011227420.1 | phosphate acetyltransferase | - |
| DR994_RS06960 (DR994_07140) | - | 1348478..1349374 (-) | 897 | WP_011226316.1 | RluA family pseudouridine synthase | - |
| DR994_RS06965 (DR994_07145) | - | 1349371..1350207 (-) | 837 | WP_041827075.1 | NAD kinase | - |
| DR994_RS06970 (DR994_07150) | - | 1350179..1350853 (-) | 675 | WP_002951443.1 | GTP pyrophosphokinase family protein | - |
| DR994_RS06975 (DR994_07155) | - | 1350949..1351524 (+) | 576 | WP_002951444.1 | CYTH domain-containing protein | - |
| DR994_RS06980 (DR994_07160) | - | 1351889..1352861 (+) | 973 | Protein_1343 | ribose-phosphate diphosphokinase | - |
| DR994_RS06985 (DR994_07165) | - | 1352865..1353977 (+) | 1113 | WP_002948029.1 | cysteine desulfurase family protein | - |
| DR994_RS06990 (DR994_07170) | - | 1353979..1354326 (+) | 348 | WP_002948028.1 | DUF1831 domain-containing protein | - |
| DR994_RS06995 (DR994_07175) | - | 1354470..1355129 (+) | 660 | WP_173940607.1 | redox-sensing transcriptional repressor Rex | - |
| DR994_RS07000 (DR994_07180) | - | 1355122..1355817 (+) | 696 | WP_173940608.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| DR994_RS07005 (DR994_07185) | radC | 1355870..1356556 (-) | 687 | WP_011226324.1 | DNA repair protein RadC | - |
| DR994_RS07010 (DR994_07190) | - | 1356605..1358389 (-) | 1785 | WP_173940609.1 | rhamnan synthesis F family protein | - |
| DR994_RS07015 (DR994_07195) | - | 1358386..1359441 (-) | 1056 | WP_002948022.1 | glycosyltransferase | - |
| DR994_RS07020 (DR994_07200) | - | 1359461..1360666 (-) | 1206 | WP_014727633.1 | ABC transporter ATP-binding protein | - |
| DR994_RS07025 (DR994_07205) | - | 1360666..1361475 (-) | 810 | WP_173940610.1 | ABC transporter permease | - |
| DR994_RS07030 (DR994_07210) | - | 1361459..1362415 (-) | 957 | WP_014727634.1 | glycosyltransferase family 2 protein | - |
| DR994_RS07035 (DR994_07215) | - | 1362412..1363560 (-) | 1149 | WP_002948014.1 | glycosyltransferase family 1 protein | - |
| DR994_RS07040 (DR994_07220) | - | 1363669..1364679 (-) | 1011 | WP_173940611.1 | glycosyltransferase family A protein | - |
| DR994_RS07045 (DR994_07225) | - | 1364679..1365953 (-) | 1275 | WP_022097028.1 | polysaccharide biosynthesis protein transporter | - |
| DR994_RS07050 (DR994_07230) | - | 1365946..1366278 (-) | 333 | WP_011226332.1 | DUF2304 domain-containing protein | - |
| DR994_RS07055 (DR994_07235) | - | 1366284..1366979 (-) | 696 | WP_173940715.1 | glycosyltransferase family 2 protein | - |
| DR994_RS07060 (DR994_07240) | rfbD | 1367056..1367907 (-) | 852 | WP_022097027.1 | dTDP-4-dehydrorhamnose reductase | - |
| DR994_RS07065 (DR994_07245) | - | 1367984..1369318 (-) | 1335 | WP_002946422.1 | DUF6056 family protein | - |
| DR994_RS07070 (DR994_07250) | - | 1369431..1370351 (-) | 921 | WP_116920321.1 | glycosyltransferase family 2 protein | - |
| DR994_RS07075 (DR994_07255) | - | 1370411..1371826 (-) | 1416 | WP_096811580.1 | DUF2142 domain-containing protein | - |
| DR994_RS07080 (DR994_07260) | - | 1372160..1372495 (-) | 336 | WP_173940612.1 | metal-sulfur cluster assembly factor | - |
| DR994_RS07085 (DR994_07265) | rpoD | 1372549..1373658 (-) | 1110 | WP_011226338.1 | RNA polymerase sigma factor RpoD | - |
| DR994_RS07090 (DR994_07270) | dnaG | 1373662..1375473 (-) | 1812 | WP_011681448.1 | DNA primase | - |
| DR994_RS07095 (DR994_07275) | mscL | 1375614..1375697 (+) | 84 | Protein_1366 | large conductance mechanosensitive channel protein MscL | - |
| DR994_RS07100 (DR994_07280) | rpsU | 1375857..1376033 (-) | 177 | WP_082309068.1 | 30S ribosomal protein S21 | - |
| DR994_RS07105 (DR994_07285) | - | 1376228..1377022 (-) | 795 | WP_022097025.1 | ABC transporter substrate-binding protein | - |
| DR994_RS07110 (DR994_07290) | - | 1377084..1378193 (-) | 1110 | WP_022097024.1 | aminotransferase | - |
| DR994_RS07115 (DR994_07295) | - | 1378539..1379336 (-) | 798 | WP_022097023.1 | transporter substrate-binding domain-containing protein | - |
| DR994_RS07120 (DR994_07300) | - | 1379333..1380163 (-) | 831 | WP_022097022.1 | transporter substrate-binding domain-containing protein | - |
| DR994_RS07125 (DR994_07305) | - | 1380377..1380841 (-) | 465 | WP_011681454.1 | 8-oxo-dGTP diphosphatase | - |
| DR994_RS07130 (DR994_07310) | uvrB | 1380886..1382877 (-) | 1992 | WP_002953358.1 | excinuclease ABC subunit UvrB | - |
| DR994_RS07135 (DR994_07315) | - | 1383024..1383491 (-) | 468 | WP_022097021.1 | hypothetical protein | - |
| DR994_RS10365 (DR994_07320) | - | 1383564..1384500 (-) | 937 | Protein_1375 | type II CAAX endopeptidase family protein | - |
| DR994_RS07145 (DR994_07325) | - | 1384699..1386909 (+) | 2211 | WP_173940613.1 | ABC transporter substrate-binding protein/permease | - |
| DR994_RS07150 (DR994_07330) | - | 1386909..1387649 (+) | 741 | WP_002945131.1 | amino acid ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 308 a.a. Molecular weight: 34694.85 Da Isoelectric Point: 9.7054
>NTDB_id=302375 DR994_RS06910 WP_002946409.1 1338851..1339777(-) (amiD) [Streptococcus thermophilus strain CS9]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
Nucleotide
Download Length: 927 bp
>NTDB_id=302375 DR994_RS06910 WP_002946409.1 1338851..1339777(-) (amiD) [Streptococcus thermophilus strain CS9]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| amiD | Streptococcus thermophilus LMG 18311 |
100 |
100 |
1 |
| amiD | Streptococcus thermophilus LMD-9 |
100 |
100 |
1 |
| amiD | Streptococcus salivarius strain HSISS4 |
96.429 |
100 |
0.964 |