Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   ETT61_RS10290 Genome accession   NZ_CP035438
Coordinates   472040..472258 (+) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm22.8     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 467040..477258
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT61_RS02560 (ETT61_02560) - 468059..468634 (+) 576 WP_136020010.1 uracil-DNA glycosylase family protein -
  ETT61_RS02565 (ETT61_02565) ybeY 468793..469290 (+) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  ETT61_RS02570 (ETT61_02570) - 469271..469678 (+) 408 WP_136020011.1 diacylglycerol kinase family protein -
  ETT61_RS02575 (ETT61_02575) era 469798..470694 (+) 897 WP_136020012.1 GTPase Era -
  ETT61_RS02580 (ETT61_02580) - 470714..471190 (+) 477 WP_002985741.1 NUDIX hydrolase -
  ETT61_RS10285 (ETT61_02585) - 471496..471750 (-) 255 WP_011184258.1 hypothetical protein -
  ETT61_RS10290 comE/blpR 472040..472258 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  ETT61_RS10295 - 472479..474061 (-) 1583 Protein_446 ABC transporter transmembrane domain-containing protein -
  ETT61_RS02610 (ETT61_02610) - 474359..474583 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  ETT61_RS10085 - 474561..474737 (+) 177 WP_002994581.1 hypothetical protein -
  ETT61_RS10495 (ETT61_02615) - 475032..475343 (+) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  ETT61_RS10440 - 475428..475556 (+) 129 WP_002994583.1 hypothetical protein -
  ETT61_RS02620 (ETT61_02620) - 475954..476181 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  ETT61_RS02625 (ETT61_02625) - 476230..476547 (+) 318 WP_136020014.1 role in replication -
  ETT61_RS10500 (ETT61_02630) - 476613..476846 (+) 234 WP_137002100.1 transposase -
  ETT61_RS10505 (ETT61_02635) - 476926..477222 (+) 297 WP_137002103.1 IS3 family transposase -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=301983 ETT61_RS10290 WP_072135532.1 472040..472258(+) (comE/blpR) [Streptococcus pyogenes strain emm22.8]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=301983 ETT61_RS10290 WP_072135532.1 472040..472258(+) (comE/blpR) [Streptococcus pyogenes strain emm22.8]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417