Detailed information NTG0301796

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: DRA65_RS11500
• Genome accession: NZ_CP030826
• Coordinates: 1898087..1898218 (+)
• Length: 43 a.a.
• NCBI ID: WP_306807169.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain 11-251
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1893087..1903218

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DRA65_RS09560 (DRA65_11270)	-	1893929..1894414 (+)	486	WP_002215245.1	CinA family protein	-
DRA65_RS09565 (DRA65_11275)	msrAB	1894516..1896084 (-)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
DRA65_RS09570 (DRA65_11285)	pilA	1896230..1897495 (+)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
DRA65_RS11500	pilC	1898087..1898218 (+)	132	WP_306807169.1	hypothetical protein	Machinery gene
DRA65_RS09575 (DRA65_11290)	pilC	1898188..1901250 (+)	3063	Protein_1856	PilC family type IV pilus tip adhesin	-

Sequence

Protein

• Length: 43 a.a.
• Molecular weight: 5193.18 Da
• Isoelectric Point: 12.6443

>NTDB_id=301796 DRA65_RS11500 WP_306807169.1 1898087..1898218(+) (pilC) [Neisseria meningitidis strain 11-251]
MNKTWKRQVFRHTALYTAILMFSHTGGGGRRKRKRKRINTLLY

Nucleotide

• Length: 132 bp

>NTDB_id=301796 DRA65_RS11500 WP_306807169.1 1898087..1898218(+) (pilC) [Neisseria meningitidis strain 11-251]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGCAGGCGCAAGCGCAAACGCAAACGCATAAATACGCTATTGTACTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	77.778	83.721	0.651