Detailed information NTG0301747

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: DRA66_RS11370
• Genome accession: NZ_CP030825
• Coordinates: 1887432..1887569 (+)
• Length: 45 a.a.
• NCBI ID: WP_192887912.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain 12-208
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1882432..1892569

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DRA66_RS09445 (DRA66_11195)	-	1883274..1883759 (+)	486	WP_002215245.1	CinA family protein	-
DRA66_RS09450 (DRA66_11200)	msrAB	1883861..1885429 (-)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
DRA66_RS09455 (DRA66_11210)	pilA	1885575..1886840 (+)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
DRA66_RS11370	pilC	1887432..1887569 (+)	138	WP_192887912.1	hypothetical protein	Machinery gene
DRA66_RS09465 (DRA66_11215)	pilC	1887533..1890598 (+)	3066	Protein_1828	PilC family type IV pilus tip adhesin	-

Sequence

Protein

• Length: 45 a.a.
• Molecular weight: 5477.54 Da
• Isoelectric Point: 12.7388

>NTDB_id=301747 DRA66_RS11370 WP_192887912.1 1887432..1887569(+) (pilC) [Neisseria meningitidis strain 12-208]
MNKTWKRQVFRHTALYTAILMFSHTGGGGRRKRKRKRKRINTLLY

Nucleotide

• Length: 138 bp

>NTDB_id=301747 DRA66_RS11370 WP_192887912.1 1887432..1887569(+) (pilC) [Neisseria meningitidis strain 12-208]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGCAGGCGCAAGCGCAAACGCAAACGCAAACGCATAAATACGCTATTGTACTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	77.778	80	0.622