Detailed information NTG0301652

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: DRA75_RS11425
• Genome accession: NZ_CP030816
• Coordinates: 1891758..1891889 (+)
• Length: 43 a.a.
• NCBI ID: WP_306807169.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain 16-92
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1886758..1896889

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DRA75_RS09470 (DRA75_11215)	-	1887600..1888085 (+)	486	WP_002215245.1	CinA family protein	-
DRA75_RS09475 (DRA75_11220)	msrAB	1888187..1889755 (-)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
DRA75_RS09480 (DRA75_11230)	pilA	1889901..1891166 (+)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
DRA75_RS11425	pilC	1891758..1891889 (+)	132	WP_306807169.1	hypothetical protein	Machinery gene
DRA75_RS09485 (DRA75_11235)	pilC	1891859..1894921 (+)	3063	Protein_1836	PilC family type IV pilus tip adhesin	-

Sequence

Protein

• Length: 43 a.a.
• Molecular weight: 5193.18 Da
• Isoelectric Point: 12.6443

>NTDB_id=301652 DRA75_RS11425 WP_306807169.1 1891758..1891889(+) (pilC) [Neisseria meningitidis strain 16-92]
MNKTWKRQVFRHTALYTAILMFSHTGGGGRRKRKRKRINTLLY

Nucleotide

• Length: 132 bp

>NTDB_id=301652 DRA75_RS11425 WP_306807169.1 1891758..1891889(+) (pilC) [Neisseria meningitidis strain 16-92]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGCAGGCGCAAGCGCAAACGCAAACGCATAAATACGCTATTGTACTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	77.778	83.721	0.651