Detailed information NTG0301603

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: DRA77_RS11415
• Genome accession: NZ_CP030814
• Coordinates: 1895113..1895247 (+)
• Length: 44 a.a.
• NCBI ID: WP_306460250.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain 16-579
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1890113..1900247

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DRA77_RS09510 (DRA77_11255)	-	1890955..1891440 (+)	486	WP_002215245.1	CinA family protein	-
DRA77_RS09515 (DRA77_11260)	msrAB	1891542..1893110 (-)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
DRA77_RS09520 (DRA77_11270)	pilA	1893256..1894521 (+)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
DRA77_RS11415	pilC	1895113..1895247 (+)	135	WP_306460250.1	hypothetical protein	Machinery gene
DRA77_RS09525 (DRA77_11275)	pilC	1895214..1898276 (+)	3063	Protein_1838	PilC family type IV pilus tip adhesin	-

Sequence

Protein

• Length: 44 a.a.
• Molecular weight: 5250.23 Da
• Isoelectric Point: 12.6443

>NTDB_id=301603 DRA77_RS11415 WP_306460250.1 1895113..1895247(+) (pilC) [Neisseria meningitidis strain 16-579]
MNKTWKRQVFRHTALYTAILMFSHTGGGGGRRKRKRKRINTLLY

Nucleotide

• Length: 135 bp

>NTDB_id=301603 DRA77_RS11415 WP_306460250.1 1895113..1895247(+) (pilC) [Neisseria meningitidis strain 16-579]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGGGGCAGGCGCAAGCGCAAACGCAAACGCATAAATACGCTATTGTACTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	90	68.182	0.614