Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ETL60_RS16525 Genome accession   NZ_CP035414
Coordinates   3058359..3058499 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103637     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3053359..3063499
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETL60_RS16500 (ETL60_16500) yuxO 3053710..3054090 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ETL60_RS16505 (ETL60_16505) comA 3054109..3054753 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETL60_RS16510 (ETL60_16510) comP 3054834..3057131 (-) 2298 WP_087614687.1 histidine kinase Regulator
  ETL60_RS16515 (ETL60_16515) comX 3057139..3057300 (-) 162 WP_003241045.1 competence pheromone ComX -
  ETL60_RS16520 (ETL60_16520) comQ 3057315..3058175 (-) 861 WP_046160795.1 polyprenyl synthetase family protein Regulator
  ETL60_RS16525 (ETL60_16525) degQ 3058359..3058499 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETL60_RS16530 (ETL60_16530) - 3058721..3058846 (+) 126 WP_003228793.1 hypothetical protein -
  ETL60_RS16535 (ETL60_16535) - 3058961..3059329 (+) 369 WP_046381300.1 hypothetical protein -
  ETL60_RS16540 (ETL60_16540) pdeH 3059305..3060534 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  ETL60_RS16545 (ETL60_16545) pncB 3060671..3062143 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ETL60_RS16550 (ETL60_16550) pncA 3062159..3062710 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  ETL60_RS16555 (ETL60_16555) yueI 3062807..3063205 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=300730 ETL60_RS16525 WP_003220708.1 3058359..3058499(-) (degQ) [Bacillus subtilis strain SRCM103637]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=300730 ETL60_RS16525 WP_003220708.1 3058359..3058499(-) (degQ) [Bacillus subtilis strain SRCM103637]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment