Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ETA57_RS14050 Genome accession   NZ_CP035404
Coordinates   2680029..2680466 (-) Length   145 a.a.
NCBI ID   WP_026699159.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SRCM103583     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2675029..2685466
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA57_RS14000 (ETA57_14000) sinI 2675198..2675374 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  ETA57_RS14005 (ETA57_14005) sinR 2675408..2675743 (+) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  ETA57_RS14010 (ETA57_14010) - 2675848..2676642 (-) 795 WP_003183447.1 TasA family protein -
  ETA57_RS14015 (ETA57_14015) - 2676716..2677300 (-) 585 WP_003183449.1 signal peptidase I -
  ETA57_RS14020 (ETA57_14020) tapA 2677297..2678025 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  ETA57_RS14025 (ETA57_14025) - 2678335..2678622 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  ETA57_RS14030 (ETA57_14030) - 2678652..2678834 (-) 183 WP_003183456.1 YqzE family protein -
  ETA57_RS14035 (ETA57_14035) comGG 2678923..2679288 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  ETA57_RS14040 (ETA57_14040) comGF 2679301..2679789 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  ETA57_RS14045 (ETA57_14045) comGE 2679698..2680045 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -
  ETA57_RS14050 (ETA57_14050) comGD 2680029..2680466 (-) 438 WP_026699159.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETA57_RS14055 (ETA57_14055) comGC 2680472..2680765 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  ETA57_RS14060 (ETA57_14060) comGB 2680779..2681813 (-) 1035 WP_026699158.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETA57_RS14065 (ETA57_14065) comGA 2681803..2682867 (-) 1065 WP_069500612.1 competence type IV pilus ATPase ComGA Machinery gene
  ETA57_RS14070 (ETA57_14070) - 2683024..2683863 (-) 840 WP_003183480.1 STAS domain-containing protein -
  ETA57_RS14080 (ETA57_14080) - 2684105..2684482 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  ETA57_RS14085 (ETA57_14085) - 2684691..2684936 (+) 246 WP_003183483.1 DUF2626 domain-containing protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16275.10 Da        Isoelectric Point: 9.6134

>NTDB_id=299954 ETA57_RS14050 WP_026699159.1 2680029..2680466(-) (comGD) [Bacillus licheniformis strain SRCM103583]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKYSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=299954 ETA57_RS14050 WP_026699159.1 2680029..2680466(-) (comGD) [Bacillus licheniformis strain SRCM103583]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGTATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.86

98.621

0.393


Multiple sequence alignment