Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SP70585_RS02955 | Genome accession | NC_012468 |
| Coordinates | 543071..543220 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae 70585 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 538071..548220
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP70585_RS02890 (SP70585_0589) | blpI | 538106..538303 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| SP70585_RS02895 (SP70585_0590) | blpJ | 538770..539039 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| SP70585_RS02900 (SP70585_0591) | blpU | 539108..539338 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| SP70585_RS02905 (SP70585_0592) | - | 539341..539460 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| SP70585_RS12200 (SP70585_0594) | - | 539757..539921 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| SP70585_RS02920 (SP70585_0595) | - | 539918..540322 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| SP70585_RS13100 | - | 540423..541237 (+) | 815 | Protein_564 | IS5-like element IS1515 family transposase | - |
| SP70585_RS12205 | - | 541398..542204 (+) | 807 | Protein_565 | IS5 family transposase | - |
| SP70585_RS02945 (SP70585_0600) | blpM | 542354..542608 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| SP70585_RS02950 (SP70585_0601) | blpN | 542624..542827 (+) | 204 | WP_001099491.1 | two-peptide bacteriocin subunit BlpN | - |
| SP70585_RS02955 (SP70585_0602) | cipB | 543071..543220 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| SP70585_RS02960 (SP70585_0604) | - | 543324..543443 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SP70585_RS02970 (SP70585_0606) | - | 544229..544612 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| SP70585_RS02975 (SP70585_0607) | - | 544664..545353 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SP70585_RS02980 (SP70585_0608) | blpZ | 545395..545643 (+) | 249 | WP_000276509.1 | immunity protein BlpZ | - |
| SP70585_RS02985 (SP70585_0609) | - | 545673..546284 (+) | 612 | WP_000394040.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SP70585_RS02990 (SP70585_0610) | ccrZ | 546446..547240 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| SP70585_RS02995 (SP70585_0611) | trmB | 547237..547872 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=29993 SP70585_RS02955 WP_001818346.1 543071..543220(+) (cipB) [Streptococcus pneumoniae 70585]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=29993 SP70585_RS02955 WP_001818346.1 543071..543220(+) (cipB) [Streptococcus pneumoniae 70585]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |