Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ETA19_RS16360 Genome accession   NZ_CP035401
Coordinates   3125036..3125176 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103837     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3120036..3130176
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA19_RS16335 (ETA19_16335) yuxO 3120349..3120729 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ETA19_RS16340 (ETA19_16340) comA 3120748..3121392 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETA19_RS16345 (ETA19_16345) comP 3121473..3123782 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  ETA19_RS16350 (ETA19_16350) comX 3123797..3123964 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ETA19_RS16355 (ETA19_16355) comQ 3123952..3124851 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ETA19_RS16360 (ETA19_16360) degQ 3125036..3125176 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETA19_RS16365 (ETA19_16365) - 3125398..3125523 (+) 126 WP_003228793.1 hypothetical protein -
  ETA19_RS16370 (ETA19_16370) - 3125637..3126005 (+) 369 WP_128993338.1 hypothetical protein -
  ETA19_RS16375 (ETA19_16375) pdeH 3125981..3127210 (-) 1230 WP_128993339.1 cyclic di-GMP phosphodiesterase -
  ETA19_RS16380 (ETA19_16380) pncB 3127347..3128819 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ETA19_RS16385 (ETA19_16385) pncA 3128835..3129386 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  ETA19_RS16390 (ETA19_16390) yueI 3129483..3129881 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=299540 ETA19_RS16360 WP_003220708.1 3125036..3125176(-) (degQ) [Bacillus subtilis strain SRCM103837]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299540 ETA19_RS16360 WP_003220708.1 3125036..3125176(-) (degQ) [Bacillus subtilis strain SRCM103837]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment