Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CHN55_RS04395 | Genome accession | NZ_CP030136 |
| Coordinates | 818277..818705 (+) | Length | 142 a.a. |
| NCBI ID | WP_031886357.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain S57 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 811892..858679 | 818277..818705 | within | 0 |
Gene organization within MGE regions
Location: 811892..858679
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CHN55_RS04325 (CHN55_04325) | - | 811892..812938 (-) | 1047 | WP_031886361.1 | tyrosine-type recombinase/integrase | - |
| CHN55_RS04330 (CHN55_04330) | - | 813000..813503 (-) | 504 | WP_129409663.1 | hypothetical protein | - |
| CHN55_RS04335 (CHN55_04335) | - | 813522..813983 (-) | 462 | WP_129409664.1 | toxin | - |
| CHN55_RS04340 (CHN55_04340) | - | 813996..814310 (-) | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | - |
| CHN55_RS04345 (CHN55_04345) | - | 814462..814698 (+) | 237 | WP_001121027.1 | helix-turn-helix transcriptional regulator | - |
| CHN55_RS04350 (CHN55_04350) | - | 814712..815488 (+) | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| CHN55_RS04355 (CHN55_04355) | - | 815517..815660 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| CHN55_RS04360 (CHN55_04360) | - | 815670..816323 (-) | 654 | WP_031886359.1 | hypothetical protein | - |
| CHN55_RS04365 (CHN55_04365) | - | 816395..816616 (+) | 222 | WP_000594790.1 | hypothetical protein | - |
| CHN55_RS04370 (CHN55_04370) | - | 816609..816770 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| CHN55_RS04375 (CHN55_04375) | - | 816863..817165 (+) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| CHN55_RS04380 (CHN55_04380) | - | 817170..817430 (+) | 261 | WP_031886358.1 | DUF1108 family protein | - |
| CHN55_RS04385 (CHN55_04385) | - | 817440..817661 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| CHN55_RS04390 (CHN55_04390) | - | 817654..818277 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| CHN55_RS04395 (CHN55_04395) | ssbA | 818277..818705 (+) | 429 | WP_031886357.1 | single-stranded DNA-binding protein | Machinery gene |
| CHN55_RS04400 (CHN55_04400) | - | 818719..819414 (+) | 696 | WP_001121808.1 | putative HNHc nuclease | - |
| CHN55_RS04405 (CHN55_04405) | - | 819386..820207 (+) | 822 | WP_031886356.1 | phage replisome organizer N-terminal domain-containing protein | - |
| CHN55_RS04410 (CHN55_04410) | - | 820220..821005 (+) | 786 | WP_024273306.1 | ATP-binding protein | - |
| CHN55_RS04415 (CHN55_04415) | - | 821002..821160 (+) | 159 | WP_000628839.1 | hypothetical protein | - |
| CHN55_RS04420 (CHN55_04420) | - | 821173..821394 (+) | 222 | WP_001123692.1 | DUF3269 family protein | - |
| CHN55_RS04425 (CHN55_04425) | - | 821405..821809 (+) | 405 | WP_000049789.1 | DUF1064 domain-containing protein | - |
| CHN55_RS04430 (CHN55_04430) | - | 821814..821999 (+) | 186 | WP_129409665.1 | DUF3113 family protein | - |
| CHN55_RS04435 (CHN55_04435) | - | 822000..822617 (+) | 618 | WP_000907339.1 | SA1788 family PVL leukocidin-associated protein | - |
| CHN55_RS04440 (CHN55_04440) | - | 822617..822871 (+) | 255 | WP_000022719.1 | DUF3310 domain-containing protein | - |
| CHN55_RS04445 (CHN55_04445) | - | 822871..823119 (+) | 249 | WP_060474161.1 | SAV1978 family virulence-associated passenger protein | - |
| CHN55_RS04450 (CHN55_04450) | - | 823133..823339 (+) | 207 | WP_000693989.1 | hypothetical protein | - |
| CHN55_RS04455 (CHN55_04455) | - | 823342..823746 (+) | 405 | WP_031886354.1 | hypothetical protein | - |
| CHN55_RS04460 (CHN55_04460) | - | 823743..823937 (+) | 195 | WP_000983953.1 | hypothetical protein | - |
| CHN55_RS04465 (CHN55_04465) | - | 823934..824386 (+) | 453 | WP_000982706.1 | YopX family protein | - |
| CHN55_RS04470 (CHN55_04470) | - | 824383..824784 (+) | 402 | WP_078099874.1 | hypothetical protein | - |
| CHN55_RS04475 (CHN55_04475) | - | 824781..825128 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| CHN55_RS04480 (CHN55_04480) | - | 825125..825433 (+) | 309 | WP_060585319.1 | hypothetical protein | - |
| CHN55_RS04485 (CHN55_04485) | - | 825426..825677 (+) | 252 | WP_031886311.1 | DUF1024 family protein | - |
| CHN55_RS14885 | - | 825667..825840 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| CHN55_RS14890 | - | 825841..826002 (+) | 162 | WP_000889680.1 | hypothetical protein | - |
| CHN55_RS04490 (CHN55_04490) | - | 826017..826523 (+) | 507 | WP_001061834.1 | dUTPase | - |
| CHN55_RS04495 (CHN55_04495) | - | 826560..826766 (+) | 207 | WP_129409666.1 | DUF1381 domain-containing protein | - |
| CHN55_RS04500 (CHN55_04500) | - | 826763..827149 (+) | 387 | WP_000592215.1 | hypothetical protein | - |
| CHN55_RS04505 (CHN55_04505) | - | 827146..827298 (+) | 153 | WP_045179128.1 | transcriptional activator RinB | - |
| CHN55_RS04510 (CHN55_04510) | - | 827366..827566 (+) | 201 | WP_031886313.1 | DUF1514 family protein | - |
| CHN55_RS04515 (CHN55_04515) | - | 827618..830065 (+) | 2448 | WP_129409667.1 | virulence-associated E family protein | - |
| CHN55_RS04525 (CHN55_04525) | - | 830167..830271 (-) | 105 | WP_078098968.1 | hypothetical protein | - |
| CHN55_RS04530 (CHN55_04530) | - | 830405..830695 (+) | 291 | WP_000665205.1 | VRR-NUC domain-containing protein | - |
| CHN55_RS04535 (CHN55_04535) | - | 830676..832043 (+) | 1368 | WP_129409668.1 | DEAD/DEAH box helicase | - |
| CHN55_RS04540 (CHN55_04540) | - | 832056..832493 (+) | 438 | WP_129409669.1 | transcriptional regulator | - |
| CHN55_RS04545 (CHN55_04545) | - | 832650..832964 (+) | 315 | WP_015978060.1 | HNH endonuclease | - |
| CHN55_RS04550 (CHN55_04550) | - | 833092..833397 (+) | 306 | WP_000778933.1 | P27 family phage terminase small subunit | - |
| CHN55_RS04555 (CHN55_04555) | - | 833387..835078 (+) | 1692 | WP_031886315.1 | terminase TerL endonuclease subunit | - |
| CHN55_RS04560 (CHN55_04560) | - | 835083..836321 (+) | 1239 | WP_001100669.1 | phage portal protein | - |
| CHN55_RS04565 (CHN55_04565) | - | 836305..837078 (+) | 774 | WP_031886316.1 | head maturation protease, ClpP-related | - |
| CHN55_RS04570 (CHN55_04570) | - | 837090..838253 (+) | 1164 | WP_031886317.1 | phage major capsid protein | - |
| CHN55_RS04575 (CHN55_04575) | - | 838322..838600 (+) | 279 | WP_000050973.1 | head-tail connector protein | - |
| CHN55_RS04580 (CHN55_04580) | - | 838612..838944 (+) | 333 | WP_000395498.1 | hypothetical protein | - |
| CHN55_RS04585 (CHN55_04585) | - | 838941..839342 (+) | 402 | WP_000110015.1 | hypothetical protein | - |
| CHN55_RS04590 (CHN55_04590) | - | 839343..839738 (+) | 396 | WP_001636966.1 | DUF3168 domain-containing protein | - |
| CHN55_RS04595 (CHN55_04595) | - | 839773..840414 (+) | 642 | WP_000807542.1 | major tail protein | - |
| CHN55_RS04600 (CHN55_04600) | - | 840506..840961 (+) | 456 | WP_031886319.1 | Ig-like domain-containing protein | - |
| CHN55_RS04605 (CHN55_04605) | - | 841019..841369 (+) | 351 | WP_000589165.1 | hypothetical protein | - |
| CHN55_RS04610 (CHN55_04610) | - | 841411..841569 (+) | 159 | WP_000438833.1 | hypothetical protein | - |
| CHN55_RS04615 (CHN55_04615) | - | 841583..847783 (+) | 6201 | WP_129409670.1 | phage tail tape measure protein | - |
| CHN55_RS04620 (CHN55_04620) | - | 847783..848607 (+) | 825 | WP_031886321.1 | phage tail family protein | - |
| CHN55_RS04625 (CHN55_04625) | - | 848616..850199 (+) | 1584 | WP_031886322.1 | prophage endopeptidase tail family protein | - |
| CHN55_RS04630 (CHN55_04630) | - | 850199..850489 (+) | 291 | WP_000179860.1 | hypothetical protein | - |
| CHN55_RS04635 (CHN55_04635) | - | 850505..852415 (+) | 1911 | WP_000429551.1 | minor structural protein | - |
| CHN55_RS04640 (CHN55_04640) | - | 852415..853881 (+) | 1467 | WP_031886323.1 | BppU family phage baseplate upper protein | - |
| CHN55_RS04645 (CHN55_04645) | - | 853881..854270 (+) | 390 | WP_001166599.1 | DUF2977 domain-containing protein | - |
| CHN55_RS04650 (CHN55_04650) | - | 854263..854427 (+) | 165 | WP_000916020.1 | XkdX family protein | - |
| CHN55_RS04655 (CHN55_04655) | - | 854473..854772 (+) | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| CHN55_RS04660 (CHN55_04660) | - | 854908..855345 (+) | 438 | WP_031883911.1 | phage holin | - |
| CHN55_RS04665 (CHN55_04665) | - | 855326..856771 (+) | 1446 | WP_031883912.1 | SH3 domain-containing protein | - |
| CHN55_RS04670 (CHN55_04670) | - | 856861..857361 (-) | 501 | WP_113559807.1 | hypothetical protein | - |
| CHN55_RS04675 (CHN55_04675) | - | 858091..858171 (-) | 81 | WP_100250272.1 | hypothetical protein | - |
| CHN55_RS04680 (CHN55_04680) | - | 858518..858679 (+) | 162 | WP_001005407.1 | SE1561 family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15918.61 Da Isoelectric Point: 8.4825
>NTDB_id=299526 CHN55_RS04395 WP_031886357.1 818277..818705(+) (ssbA) [Staphylococcus aureus strain S57]
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=299526 CHN55_RS04395 WP_031886357.1 818277..818705(+) (ssbA) [Staphylococcus aureus strain S57]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATTAAGAAGCACACCGAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGTGAGCGTGAAGCAGACTTTATTAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTATCTTTCTAAAGGATCACTGGCAGGTGTTGACGGACGATTACAAACACGT
AGCTACGATAACAAAGTCGGGCAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATTAAGAAGCACACCGAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGTGAGCGTGAAGCAGACTTTATTAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTATCTTTCTAAAGGATCACTGGCAGGTGTTGACGGACGATTACAAACACGT
AGCTACGATAACAAAGTCGGGCAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |