Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETA19_RS12435 Genome accession   NZ_CP035401
Coordinates   2416786..2416959 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103837     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2411786..2421959
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA19_RS12420 (ETA19_12420) gcvT 2412586..2413674 (-) 1089 WP_128993147.1 glycine cleavage system aminomethyltransferase GcvT -
  ETA19_RS12425 (ETA19_12425) hepAA 2414115..2415788 (+) 1674 WP_128993149.1 SNF2-related protein -
  ETA19_RS12430 (ETA19_12430) yqhG 2415809..2416603 (+) 795 WP_003230200.1 YqhG family protein -
  ETA19_RS12435 (ETA19_12435) sinI 2416786..2416959 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA19_RS12440 (ETA19_12440) sinR 2416993..2417328 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA19_RS12445 (ETA19_12445) tasA 2417421..2418206 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ETA19_RS12450 (ETA19_12450) sipW 2418270..2418842 (-) 573 WP_128993656.1 signal peptidase I SipW -
  ETA19_RS12455 (ETA19_12455) tapA 2418826..2419587 (-) 762 WP_128993152.1 amyloid fiber anchoring/assembly protein TapA -
  ETA19_RS12460 (ETA19_12460) yqzG 2419859..2420185 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETA19_RS12465 (ETA19_12465) spoIITA 2420227..2420406 (-) 180 WP_014480252.1 YqzE family protein -
  ETA19_RS12470 (ETA19_12470) comGG 2420478..2420852 (-) 375 WP_128993153.1 ComG operon protein ComGG Machinery gene
  ETA19_RS12475 (ETA19_12475) comGF 2420853..2421236 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  ETA19_RS12480 (ETA19_12480) comGE 2421262..2421609 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=299504 ETA19_RS12435 WP_003230187.1 2416786..2416959(+) (sinI) [Bacillus subtilis strain SRCM103837]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=299504 ETA19_RS12435 WP_003230187.1 2416786..2416959(+) (sinI) [Bacillus subtilis strain SRCM103837]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment