Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   AB432_RS10275 Genome accession   NZ_CP030117
Coordinates   2030853..2031281 (-) Length   142 a.a.
NCBI ID   WP_048032199.1    Uniprot ID   -
Organism   Brevibacillus brevis strain DZQ7     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2006896..2032817 2030853..2031281 within 0


Gene organization within MGE regions


Location: 2006896..2032817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB432_RS10100 (AB432_010100) - 2006896..2007204 (-) 309 WP_048032176.1 hypothetical protein -
  AB432_RS10115 (AB432_010115) - 2008151..2008582 (+) 432 WP_048032179.1 hypothetical protein -
  AB432_RS10120 (AB432_010120) - 2009110..2009496 (-) 387 WP_048032180.1 hypothetical protein -
  AB432_RS10125 (AB432_010125) - 2009639..2009917 (-) 279 WP_235617655.1 hypothetical protein -
  AB432_RS30700 - 2010248..2010610 (+) 363 WP_201265919.1 hypothetical protein -
  AB432_RS10135 (AB432_010135) - 2010802..2011440 (-) 639 WP_048032181.1 hypothetical protein -
  AB432_RS31475 - 2011598..2011738 (-) 141 WP_419178473.1 hypothetical protein -
  AB432_RS10140 (AB432_010140) - 2011683..2011889 (-) 207 WP_048032182.1 hypothetical protein -
  AB432_RS10145 (AB432_010145) - 2012027..2012413 (+) 387 WP_048032183.1 ArpU family phage packaging/lysis transcriptional regulator -
  AB432_RS10155 (AB432_010155) - 2013229..2013723 (+) 495 WP_048032185.1 hypothetical protein -
  AB432_RS10160 (AB432_010160) - 2013943..2014455 (+) 513 WP_048032186.1 ParB N-terminal domain-containing protein -
  AB432_RS31015 - 2014452..2014631 (+) 180 WP_235617656.1 hypothetical protein -
  AB432_RS31020 - 2014680..2014925 (+) 246 WP_235617657.1 hypothetical protein -
  AB432_RS10170 (AB432_010170) - 2015189..2015422 (+) 234 WP_048032187.1 hypothetical protein -
  AB432_RS10175 (AB432_010175) - 2015468..2015878 (+) 411 WP_048032188.1 hypothetical protein -
  AB432_RS10180 (AB432_010180) - 2015955..2016599 (+) 645 WP_048032189.1 hypothetical protein -
  AB432_RS31025 (AB432_010185) - 2016694..2017278 (+) 585 WP_235617658.1 hypothetical protein -
  AB432_RS10190 (AB432_010190) - 2017295..2017609 (+) 315 WP_235617732.1 phage minor head protein -
  AB432_RS31275 - 2017998..2018345 (+) 348 WP_268811851.1 XkdF-like putative serine protease domain-containing protein -
  AB432_RS31280 - 2018380..2018568 (+) 189 WP_268811852.1 XkdF-like putative serine protease domain-containing protein -
  AB432_RS31480 - 2018712..2018795 (+) 84 WP_419178481.1 putative holin-like toxin -
  AB432_RS10200 (AB432_010200) - 2018863..2019282 (+) 420 WP_048032190.1 HD domain-containing protein -
  AB432_RS10205 (AB432_010205) - 2019408..2019995 (+) 588 WP_048032191.1 hypothetical protein -
  AB432_RS10210 (AB432_010210) - 2020213..2020536 (+) 324 WP_048032192.1 hypothetical protein -
  AB432_RS10215 (AB432_010215) - 2020633..2020782 (+) 150 WP_162630234.1 hypothetical protein -
  AB432_RS10220 (AB432_010220) - 2020919..2021356 (+) 438 WP_053079564.1 hypothetical protein -
  AB432_RS31285 - 2021491..2021613 (+) 123 WP_256434908.1 hypothetical protein -
  AB432_RS31485 - 2021833..2022122 (+) 290 Protein_1920 YolD-like family protein -
  AB432_RS31490 (AB432_010230) - 2022276..2023289 (+) 1014 WP_419178482.1 acyltransferase -
  AB432_RS10235 (AB432_010235) - 2023529..2024362 (-) 834 WP_048032195.1 discoidin domain-containing protein -
  AB432_RS10240 (AB432_010240) - 2024607..2026107 (+) 1501 Protein_1923 recombinase family protein -
  AB432_RS10245 (AB432_010245) - 2026141..2026514 (+) 374 Protein_1924 sigma-70 family RNA polymerase sigma factor -
  AB432_RS30480 - 2026994..2027179 (-) 186 WP_162630235.1 hypothetical protein -
  AB432_RS10250 (AB432_010250) - 2027231..2027563 (-) 333 WP_048032196.1 DUF2834 domain-containing protein -
  AB432_RS31495 (AB432_010255) - 2027990..2028106 (+) 117 WP_113732267.1 YopX family protein -
  AB432_RS10260 (AB432_010260) - 2028175..2028621 (-) 447 WP_082195898.1 hypothetical protein -
  AB432_RS10265 (AB432_010265) - 2029213..2029692 (-) 480 WP_048032197.1 hypothetical protein -
  AB432_RS10270 (AB432_010270) - 2030064..2030618 (+) 555 WP_048032198.1 hypothetical protein -
  AB432_RS10275 (AB432_010275) nucA/comI 2030853..2031281 (-) 429 WP_048032199.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  AB432_RS10280 (AB432_010280) - 2031815..2032300 (+) 486 WP_048032200.1 hypothetical protein -
  AB432_RS10285 (AB432_010285) - 2032398..2032817 (+) 420 WP_048032201.1 hypothetical protein -

Sequence


Protein


Download         Length: 142 a.a.        Molecular weight: 15529.76 Da        Isoelectric Point: 6.8630

>NTDB_id=299375 AB432_RS10275 WP_048032199.1 2030853..2031281(-) (nucA/comI) [Brevibacillus brevis strain DZQ7]
MTHRKMLMLIVVLLVGAAYFFGLVPIENKTVSNGNVDHTIVFPSDRYPQTAKHIKKAIASGKSAVCTIDRDGADENREES
LKGIPTKKGLDRDEWPMAMCAEGGTGAHIEYISPSDNRGAGSWISNQLEDFPNGTKVEILVK

Nucleotide


Download         Length: 429 bp        

>NTDB_id=299375 AB432_RS10275 WP_048032199.1 2030853..2031281(-) (nucA/comI) [Brevibacillus brevis strain DZQ7]
ATGACACACAGAAAAATGCTGATGTTGATTGTGGTGCTGCTGGTCGGAGCCGCCTATTTCTTTGGACTTGTGCCAATAGA
GAACAAAACAGTCAGCAACGGGAACGTAGACCATACGATTGTTTTTCCATCTGATCGATACCCTCAGACTGCAAAGCATA
TCAAAAAAGCGATTGCCTCTGGGAAGTCCGCTGTATGTACAATTGACCGCGATGGAGCAGATGAAAATCGTGAAGAATCA
CTCAAAGGCATACCTACAAAAAAGGGACTCGATCGAGACGAATGGCCGATGGCAATGTGTGCTGAGGGTGGAACAGGGGC
ACATATCGAATACATATCACCATCCGATAATCGAGGAGCTGGATCGTGGATTTCCAATCAACTAGAGGATTTTCCAAACG
GAACTAAGGTTGAAATCCTGGTCAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

64.655

81.69

0.528


Multiple sequence alignment