Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ETA10_RS16395 Genome accession   NZ_CP035397
Coordinates   3029060..3029200 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103773     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3024060..3034200
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA10_RS16370 (ETA10_16370) yuxO 3024410..3024790 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  ETA10_RS16375 (ETA10_16375) comA 3024809..3025453 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETA10_RS16380 (ETA10_16380) comP 3025534..3027831 (-) 2298 WP_087614687.1 histidine kinase Regulator
  ETA10_RS16385 (ETA10_16385) comX 3027839..3028000 (-) 162 WP_003241045.1 competence pheromone ComX -
  ETA10_RS16390 (ETA10_16390) comQ 3028015..3028875 (-) 861 WP_046160795.1 polyprenyl synthetase family protein Regulator
  ETA10_RS16395 (ETA10_16395) degQ 3029060..3029200 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETA10_RS16400 (ETA10_16400) - 3029422..3029547 (+) 126 WP_120028613.1 hypothetical protein -
  ETA10_RS16405 (ETA10_16405) - 3029662..3030030 (+) 369 WP_017695529.1 hypothetical protein -
  ETA10_RS16410 (ETA10_16410) pdeH 3030006..3031235 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ETA10_RS16415 (ETA10_16415) pncB 3031372..3032844 (-) 1473 WP_129110551.1 nicotinate phosphoribosyltransferase -
  ETA10_RS16420 (ETA10_16420) pncA 3032860..3033411 (-) 552 WP_046160797.1 isochorismatase family cysteine hydrolase -
  ETA10_RS16425 (ETA10_16425) yueI 3033508..3033906 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=299237 ETA10_RS16395 WP_003220708.1 3029060..3029200(-) (degQ) [Bacillus subtilis strain SRCM103773]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299237 ETA10_RS16395 WP_003220708.1 3029060..3029200(-) (degQ) [Bacillus subtilis strain SRCM103773]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1