Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ES967_RS16065 Genome accession   NZ_CP035394
Coordinates   3080469..3080609 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103696     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3075469..3085609
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES967_RS16040 (ES967_16040) yuxO 3075746..3076126 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  ES967_RS16045 (ES967_16045) comA 3076145..3076789 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ES967_RS16050 (ES967_16050) comP 3076870..3079182 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  ES967_RS16055 (ES967_16055) comX 3079198..3079419 (-) 222 WP_014480704.1 competence pheromone ComX -
  ES967_RS16060 (ES967_16060) comQ 3079421..3080284 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  ES967_RS16065 (ES967_16065) degQ 3080469..3080609 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ES967_RS16070 (ES967_16070) - 3080831..3080956 (+) 126 WP_003228793.1 hypothetical protein -
  ES967_RS16075 (ES967_16075) - 3081071..3081439 (+) 369 WP_046381300.1 hypothetical protein -
  ES967_RS16080 (ES967_16080) pdeH 3081415..3082644 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  ES967_RS16085 (ES967_16085) pncB 3082781..3084253 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ES967_RS16090 (ES967_16090) pncA 3084269..3084820 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  ES967_RS16095 (ES967_16095) yueI 3084917..3085315 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=298938 ES967_RS16065 WP_003220708.1 3080469..3080609(-) (degQ) [Bacillus subtilis strain SRCM103696]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=298938 ES967_RS16065 WP_003220708.1 3080469..3080609(-) (degQ) [Bacillus subtilis strain SRCM103696]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1