Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ES965_RS16410 Genome accession   NZ_CP035391
Coordinates   3126498..3126638 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103689     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3121498..3131638
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES965_RS16385 (ES965_16385) yuxO 3121812..3122192 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  ES965_RS16390 (ES965_16390) comA 3122211..3122855 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ES965_RS16395 (ES965_16395) comP 3122936..3125245 (-) 2310 WP_129092677.1 two-component system sensor histidine kinase ComP Regulator
  ES965_RS16400 (ES965_16400) comX 3125260..3125427 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  ES965_RS16405 (ES965_16405) comQ 3125411..3126313 (-) 903 WP_129092678.1 polyprenyl synthetase family protein Regulator
  ES965_RS16410 (ES965_16410) degQ 3126498..3126638 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ES965_RS21865 - 3126860..3126922 (+) 63 Protein_3156 hypothetical protein -
  ES965_RS16415 (ES965_16415) - 3127100..3127468 (+) 369 WP_129092679.1 hypothetical protein -
  ES965_RS16420 (ES965_16420) pdeH 3127444..3128673 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  ES965_RS16425 (ES965_16425) pncB 3128810..3130282 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ES965_RS16430 (ES965_16430) pncA 3130298..3130849 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  ES965_RS16435 (ES965_16435) yueI 3130946..3131344 (-) 399 WP_014477837.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=298783 ES965_RS16410 WP_003220708.1 3126498..3126638(-) (degQ) [Bacillus subtilis strain SRCM103689]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=298783 ES965_RS16410 WP_003220708.1 3126498..3126638(-) (degQ) [Bacillus subtilis strain SRCM103689]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1