Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ES963_RS12840 Genome accession   NZ_CP035390
Coordinates   2386320..2386493 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103641     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2381320..2391493
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES963_RS12825 (ES963_12825) gcvT 2382119..2383207 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  ES963_RS12830 (ES963_12830) hepAA 2383649..2385322 (+) 1674 WP_014480248.1 SNF2-related protein -
  ES963_RS12835 (ES963_12835) yqhG 2385343..2386137 (+) 795 WP_014480249.1 YqhG family protein -
  ES963_RS12840 (ES963_12840) sinI 2386320..2386493 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES963_RS12845 (ES963_12845) sinR 2386527..2386862 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES963_RS12850 (ES963_12850) tasA 2386955..2387740 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ES963_RS12855 (ES963_12855) sipW 2387804..2388376 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ES963_RS12860 (ES963_12860) tapA 2388360..2389121 (-) 762 WP_087614619.1 amyloid fiber anchoring/assembly protein TapA -
  ES963_RS12865 (ES963_12865) yqzG 2389393..2389719 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  ES963_RS12870 (ES963_12870) spoIITA 2389761..2389940 (-) 180 WP_014480252.1 YqzE family protein -
  ES963_RS12875 (ES963_12875) comGG 2390011..2390385 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  ES963_RS12880 (ES963_12880) comGF 2390386..2390769 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  ES963_RS12885 (ES963_12885) comGE 2390795..2391142 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=298595 ES963_RS12840 WP_003230187.1 2386320..2386493(+) (sinI) [Bacillus subtilis strain SRCM103641]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=298595 ES963_RS12840 WP_003230187.1 2386320..2386493(+) (sinI) [Bacillus subtilis strain SRCM103641]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment