Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH17_RS02405 Genome accession   NZ_CP035263
Coordinates   485384..485533 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_1901922     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 480384..490533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH17_RS02370 (EQH17_02560) blpU 482248..482478 (+) 231 WP_001093268.1 bacteriocin-like peptide BlpU -
  EQH17_RS02375 (EQH17_02565) - 482481..482600 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  EQH17_RS02380 (EQH17_02570) - 482897..483061 (+) 165 WP_000727118.1 hypothetical protein -
  EQH17_RS02385 (EQH17_02575) - 483058..483462 (+) 405 WP_000846944.1 hypothetical protein -
  EQH17_RS02390 (EQH17_02580) - 483660..484465 (+) 806 Protein_478 IS5 family transposase -
  EQH17_RS02395 (EQH17_02585) blpM 484667..484921 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQH17_RS02400 (EQH17_02590) blpN 484937..485140 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQH17_RS02405 (EQH17_02600) cipB 485384..485533 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator
  EQH17_RS02410 (EQH17_02605) - 485637..485756 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQH17_RS02415 (EQH17_02615) - 486542..486925 (+) 384 WP_000877378.1 hypothetical protein -
  EQH17_RS02420 (EQH17_02620) - 486977..487666 (+) 690 WP_000760541.1 CPBP family intramembrane glutamic endopeptidase -
  EQH17_RS02425 (EQH17_02625) blpZ 487708..487941 (+) 234 WP_000276498.1 immunity protein BlpZ -
  EQH17_RS02430 (EQH17_02635) - 488092..488703 (+) 612 WP_000394045.1 CPBP family intramembrane glutamic endopeptidase -
  EQH17_RS02435 (EQH17_02640) ccrZ 488864..489658 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  EQH17_RS02440 (EQH17_02645) trmB 489655..490290 (+) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=297768 EQH17_RS02405 WP_001813641.1 485384..485533(+) (cipB) [Streptococcus pneumoniae strain TVO_1901922]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=297768 EQH17_RS02405 WP_001813641.1 485384..485533(+) (cipB) [Streptococcus pneumoniae strain TVO_1901922]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49