Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH24_RS02835 | Genome accession | NZ_CP035256 |
| Coordinates | 545299..545448 (+) | Length | 49 a.a. |
| NCBI ID | WP_001820573.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1901930 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 540299..550448
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH24_RS11705 | comA/nlmT | 540347..540934 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EQH24_RS02790 (EQH24_02955) | blpI | 541208..541405 (+) | 198 | WP_001093261.1 | bacteriocin-like peptide BlpI | - |
| EQH24_RS02795 (EQH24_02965) | blpJ | 541872..542141 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| EQH24_RS02800 (EQH24_02970) | blpU | 542210..542440 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| EQH24_RS02805 (EQH24_02975) | - | 542443..542562 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| EQH24_RS02810 (EQH24_02980) | - | 542859..543023 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| EQH24_RS02815 (EQH24_02985) | - | 543020..543424 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| EQH24_RS02820 (EQH24_02990) | - | 543627..544432 (+) | 806 | Protein_564 | IS5 family transposase | - |
| EQH24_RS02825 (EQH24_02995) | blpM | 544582..544836 (+) | 255 | WP_000379877.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH24_RS02830 (EQH24_03000) | blpN | 544852..545055 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH24_RS02835 (EQH24_03010) | cipB | 545299..545448 (+) | 150 | WP_001820573.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH24_RS02840 (EQH24_03015) | - | 545552..545671 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH24_RS02845 (EQH24_03025) | - | 546457..546840 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| EQH24_RS02850 (EQH24_03030) | - | 546892..547581 (+) | 690 | WP_000760510.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH24_RS02855 (EQH24_03035) | blpZ | 547623..547856 (+) | 234 | WP_001818347.1 | immunity protein BlpZ | - |
| EQH24_RS02860 (EQH24_03045) | - | 548007..548618 (+) | 612 | WP_000394049.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH24_RS02865 (EQH24_03050) | ccrZ | 548779..549573 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| EQH24_RS02870 (EQH24_03055) | trmB | 549570..550205 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.91 Da Isoelectric Point: 3.9133
>NTDB_id=296932 EQH24_RS02835 WP_001820573.1 545299..545448(+) (cipB) [Streptococcus pneumoniae strain TVO_1901930]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=296932 EQH24_RS02835 WP_001820573.1 545299..545448(+) (cipB) [Streptococcus pneumoniae strain TVO_1901930]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |