Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH35_RS02615 Genome accession   NZ_CP035245
Coordinates   496360..496509 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_1901943     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 491360..501509
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH35_RS02595 (EQH35_02720) blpC 491671..491826 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  EQH35_RS02600 (EQH35_02725) - 491883..493244 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  EQH35_RS10700 comA/nlmT 493255..493743 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  EQH35_RS10705 comA/nlmT 493727..494167 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  EQH35_RS10710 comA/nlmT 494157..494882 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  EQH35_RS10715 (EQH35_02735) comA/nlmT 494827..495414 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQH35_RS02610 (EQH35_02740) blpI 495696..495893 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  EQH35_RS02615 (EQH35_02750) cipB 496360..496509 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator
  EQH35_RS02620 (EQH35_02755) - 496613..496732 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQH35_RS02625 (EQH35_02765) - 497518..497901 (+) 384 WP_000877381.1 hypothetical protein -
  EQH35_RS02630 (EQH35_02770) - 497953..498642 (+) 690 WP_000760526.1 CPBP family intramembrane glutamic endopeptidase -
  EQH35_RS02635 (EQH35_02775) blpZ 498684..498932 (+) 249 WP_000276499.1 immunity protein BlpZ -
  EQH35_RS02640 (EQH35_02780) - 498962..499573 (+) 612 WP_000394047.1 CPBP family intramembrane glutamic endopeptidase -
  EQH35_RS02645 (EQH35_02785) ccrZ 499734..500528 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  EQH35_RS02650 (EQH35_02790) trmB 500525..501160 (+) 636 WP_001266080.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=295965 EQH35_RS02615 WP_001808912.1 496360..496509(+) (cipB) [Streptococcus pneumoniae strain TVO_1901943]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=295965 EQH35_RS02615 WP_001808912.1 496360..496509(+) (cipB) [Streptococcus pneumoniae strain TVO_1901943]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51