Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH36_RS10900 Genome accession   NZ_CP035244
Coordinates   490252..490386 (+) Length   44 a.a.
NCBI ID   WP_128903586.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_1901945     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 485252..495386
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH36_RS02440 (EQH36_02575) - 485445..486806 (-) 1362 WP_001069067.1 bacteriocin secretion accessory protein -
  EQH36_RS02445 (EQH36_02580) comA/nlmT 486817..488970 (-) 2154 WP_000205168.1 peptide cleavage/export ABC transporter BlpA Regulator
  EQH36_RS02450 (EQH36_02585) blpI 489251..489448 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  EQH36_RS02455 (EQH36_02595) blpJ 489914..490183 (+) 270 WP_001093249.1 bacteriocin-like peptide BlpJ -
  EQH36_RS10900 (EQH36_02600) cipB 490252..490386 (+) 135 WP_128903586.1 bacteriocin class II family protein Regulator
  EQH36_RS02460 - 490323..490481 (+) 159 WP_001849862.1 hypothetical protein -
  EQH36_RS02465 (EQH36_02605) - 490484..490603 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  EQH36_RS02470 (EQH36_02610) - 490900..491064 (+) 165 WP_000727118.1 hypothetical protein -
  EQH36_RS02475 (EQH36_02615) - 491061..491465 (+) 405 WP_000846943.1 hypothetical protein -
  EQH36_RS02480 (EQH36_02620) - 491668..492472 (+) 805 WP_128903587.1 IS5 family transposase -
  EQH36_RS02485 (EQH36_02625) blpM 492622..492876 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQH36_RS02490 (EQH36_02630) blpN 492892..493095 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQH36_RS02495 (EQH36_02640) cipB 493339..493488 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  EQH36_RS11040 - 493524..493589 (+) 66 Protein_501 ComC/BlpC family peptide pheromone/bacteriocin -
  EQH36_RS02500 (EQH36_02645) - 493592..493711 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQH36_RS02505 (EQH36_02655) - 494497..494880 (+) 384 WP_000877381.1 hypothetical protein -

Sequence

Protein


Download         Length: 44 a.a.        Molecular weight: 5055.79 Da        Isoelectric Point: 3.6910

>NTDB_id=295941 EQH36_RS10900 WP_128903586.1 490252..490386(+) (cipB) [Streptococcus pneumoniae strain TVO_1901945]
MDTKMMSQFSVMDTEMLACVEGGGCNWEILPKQVLEEQQQEVFN

Nucleotide


Download         Length: 135 bp        

>NTDB_id=295941 EQH36_RS10900 WP_128903586.1 490252..490386(+) (cipB) [Streptococcus pneumoniae strain TVO_1901945]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATACTGAAATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGAGATTTTGCCAAAGCAGGTGTTGGAGGAGCAGCAGCAAGAGGTCTTCAACTAG

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-27)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

43.59

88.636

0.386