Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH41_RS02515 | Genome accession | NZ_CP035239 |
| Coordinates | 516068..516217 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain TVO_TIGR4 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 511068..521217
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH41_RS10970 (EQH41_02660) | comA/nlmT | 511109..511696 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EQH41_RS02470 (EQH41_02665) | blpI | 511978..512175 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| EQH41_RS02475 (EQH41_02675) | blpJ | 512642..512911 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| EQH41_RS02480 (EQH41_02680) | blpU | 512980..513210 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| EQH41_RS02485 (EQH41_02685) | - | 513213..513332 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH41_RS02490 (EQH41_02690) | - | 513629..513793 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| EQH41_RS02495 (EQH41_02695) | - | 513790..514194 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| EQH41_RS02500 (EQH41_02700) | - | 514397..515201 (+) | 805 | WP_100214365.1 | IS5 family transposase | - |
| EQH41_RS02505 (EQH41_02705) | blpM | 515351..515605 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH41_RS02510 (EQH41_02710) | blpN | 515621..515824 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH41_RS02515 (EQH41_02720) | cipB | 516068..516217 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH41_RS02520 (EQH41_02725) | - | 516321..516440 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH41_RS02525 (EQH41_02735) | - | 517226..517609 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| EQH41_RS02530 (EQH41_02740) | - | 517661..518350 (+) | 690 | WP_000760538.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH41_RS02535 (EQH41_02745) | blpZ | 518392..518625 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| EQH41_RS02540 (EQH41_02755) | - | 518776..519387 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH41_RS02545 (EQH41_02760) | ccrZ | 519548..520342 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| EQH41_RS02550 (EQH41_02765) | trmB | 520339..520974 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=295369 EQH41_RS02515 WP_001818346.1 516068..516217(+) (cipB) [Streptococcus pneumoniae strain TVO_TIGR4]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=295369 EQH41_RS02515 WP_001818346.1 516068..516217(+) (cipB) [Streptococcus pneumoniae strain TVO_TIGR4]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |